BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780203|ref|YP_003064616.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] (82 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done Results from round 1 >gi|254780203|ref|YP_003064616.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] gi|254039880|gb|ACT56676.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] Length = 82 Score = 167 bits (423), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 82/82 (100%), Positives = 82/82 (100%) Query: 1 MDDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIEL 60 MDDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIEL Sbjct: 1 MDDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIEL 60 Query: 61 LKNKDFDGVEIERKSYNLRKNT 82 LKNKDFDGVEIERKSYNLRKNT Sbjct: 61 LKNKDFDGVEIERKSYNLRKNT 82 >gi|254781124|ref|YP_003065537.1| hypothetical protein CLIBASIA_05130 [Candidatus Liberibacter asiaticus str. psy62] gi|254040801|gb|ACT57597.1| hypothetical protein CLIBASIA_05130 [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Score = 55.1 bits (131), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 28/66 (42%), Positives = 46/66 (69%), Gaps = 3/66 (4%) Query: 2 DDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGY--ESYISHVCELIE 59 + +YRP ++EVR+AFP+++K++EK L + V+PL PV+ +G E Y H+C LI+ Sbjct: 12 EGNQYRPLRKEVRNAFPKILKSIEKALEPY-VDPLIEPVEIGKEGMVDEGYRLHICALIK 70 Query: 60 LLKNKD 65 LL+N+ Sbjct: 71 LLENRS 76 >gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] gi|254040866|gb|ACT57662.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] Length = 252 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 6/80 (7%) Query: 3 DRKYRPSKEEVRDAFP-ELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELL 61 D KYRPS E +R P +L+K E +S + +P+ + Y H C L+ L Sbjct: 177 DNKYRPSAEAMRTICPTKLMKIFEDTISLY-----VDPLTPRDISFTQYEKHACALVNWL 231 Query: 62 KNKDFDGVEIERKSYNLRKN 81 + F+ + I RK++N R Sbjct: 232 EKGKFNEMSIARKAFNRRSQ 251 >gi|195953045|ref|YP_002121335.1| glutamyl-tRNA synthetase [Hydrogenobaculum sp. Y04AAS1] gi|229470619|sp|B4U896|SYE_HYDS0 RecName: Full=Glutamyl-tRNA synthetase; AltName: Full=Glutamate--tRNA ligase; Short=GluRS gi|195932657|gb|ACG57357.1| glutamyl-tRNA synthetase [Hydrogenobaculum sp. Y04AAS1] Length = 464 Score = 38.1 bits (87), Expect = 0.38, Method: Compositional matrix adjust. Identities = 30/91 (32%), Positives = 44/91 (48%), Gaps = 12/91 (13%) Query: 3 DRKYRPSKEEVRDAFPE------LIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCE 56 D+ Y + +R+ PE L+ LEK T D+E LK VK+ K Y +Y+ V + Sbjct: 306 DKLYWLNGVYIREILPEDRLLEDLLSFLEKAYGTVDIEYLKKIVKATRKEYNTYLEAVEK 365 Query: 57 LIELLKNKDFDGV------EIERKSYNLRKN 81 L K K+ D V +I+RK + L K Sbjct: 366 LRPFFKEKELDEVAKEELSKIDRKVFELLKQ 396 >gi|117926863|ref|YP_867480.1| hypothetical protein Mmc1_3589 [Magnetococcus sp. MC-1] gi|117610619|gb|ABK46074.1| Tetratricopeptide TPR_2 repeat protein [Magnetococcus sp. MC-1] Length = 235 Score = 37.0 bits (84), Expect = 0.96, Method: Compositional matrix adjust. Identities = 20/64 (31%), Positives = 30/64 (46%) Query: 6 YRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELLKNKD 65 YR ++ D + + ++AL+K E LK HG+ +SH+ E L K D Sbjct: 56 YRAQDQDASDRYIQALEALDKDQLKVAAEALKGLQTKHGEHGYGLLSHLSEAQMLAKQGD 115 Query: 66 FDGV 69 FDG Sbjct: 116 FDGA 119 >gi|118626591|emb|CAL34031.1| methionine aminopeptidase [Candidatus Phytoplasma ulmi] gi|308523750|gb|ADO33717.1| methionine aminopeptidase [Candidatus Phytoplasma ulmi] Length = 188 Score = 34.3 bits (77), Expect = 5.4, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 6/43 (13%) Query: 19 ELIKALEKGLSTFDVEPL------KNPVKSHGKGYESYISHVC 55 EL+K L+ G+STFD++ + KN V S KGY+ + ++C Sbjct: 26 ELLKFLKVGISTFDLDMIAFDLMKKNGVVSAFKGYQGFGGYIC 68 >gi|308523732|gb|ADO33705.1| methionine aminopeptidase [Candidatus Phytoplasma ulmi] gi|308523738|gb|ADO33709.1| methionine aminopeptidase [Candidatus Phytoplasma ulmi] gi|308523741|gb|ADO33711.1| methionine aminopeptidase [Candidatus Phytoplasma ulmi] Length = 188 Score = 34.3 bits (77), Expect = 5.8, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 6/43 (13%) Query: 19 ELIKALEKGLSTFDVEPL------KNPVKSHGKGYESYISHVC 55 EL+K L+ G+STFD++ + KN V S KGY+ + ++C Sbjct: 26 ELLKFLKVGISTFDLDMIAFDLMKKNGVVSAFKGYQGFGGYIC 68 >gi|308523723|gb|ADO33699.1| methionine aminopeptidase [Candidatus Phytoplasma ulmi] gi|308523726|gb|ADO33701.1| methionine aminopeptidase [Candidatus Phytoplasma ulmi] gi|308523729|gb|ADO33703.1| methionine aminopeptidase [Candidatus Phytoplasma ulmi] gi|308523735|gb|ADO33707.1| methionine aminopeptidase [Candidatus Phytoplasma ulmi] gi|308523744|gb|ADO33713.1| methionine aminopeptidase [Candidatus Phytoplasma ulmi] gi|308523747|gb|ADO33715.1| methionine aminopeptidase [Candidatus Phytoplasma ulmi] Length = 188 Score = 34.3 bits (77), Expect = 5.8, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 6/43 (13%) Query: 19 ELIKALEKGLSTFDVEPL------KNPVKSHGKGYESYISHVC 55 EL+K L+ G+STFD++ + KN V S KGY+ + ++C Sbjct: 26 ELLKFLKVGISTFDLDMIAFDLMKKNGVVSAFKGYQGFGGYIC 68 >gi|118626588|emb|CAL34029.1| methionine aminopeptidase [Candidatus Phytoplasma ulmi] Length = 188 Score = 34.3 bits (77), Expect = 5.8, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 6/43 (13%) Query: 19 ELIKALEKGLSTFDVEPL------KNPVKSHGKGYESYISHVC 55 EL+K L+ G+STFD++ + KN V S KGY+ + ++C Sbjct: 26 ELLKFLKVGISTFDLDMIAFDLMKKNGVVSAFKGYQGFGGYIC 68 >gi|308524928|gb|ADO33792.1| methionine aminopeptidase [Candidatus Phytoplasma ulmi] Length = 183 Score = 33.9 bits (76), Expect = 6.6, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 6/43 (13%) Query: 19 ELIKALEKGLSTFDVEPL------KNPVKSHGKGYESYISHVC 55 EL+K L+ G+STFD++ + KN V S KGY+ + ++C Sbjct: 26 ELLKFLKVGISTFDLDMIAFDLMKKNGVVSAFKGYQGFGGYIC 68 >gi|118626579|emb|CAL34023.1| methionine aminopeptidase [Candidatus Phytoplasma vitis] Length = 188 Score = 33.9 bits (76), Expect = 7.7, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 6/43 (13%) Query: 19 ELIKALEKGLSTFDVEPL------KNPVKSHGKGYESYISHVC 55 EL+K L+ G+STFD++ + KN V S KGY+ + ++C Sbjct: 26 ELLKFLKVGISTFDLDMIAFDLMKKNDVISAFKGYQGFGGYIC 68 >gi|118626564|emb|CAL34013.1| methionine aminopeptidase [Candidatus Phytoplasma vitis] Length = 188 Score = 33.9 bits (76), Expect = 7.9, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 6/43 (13%) Query: 19 ELIKALEKGLSTFDVEPL------KNPVKSHGKGYESYISHVC 55 EL+K L+ G+STFD++ + KN V S KGY+ + ++C Sbjct: 26 ELLKFLKVGISTFDLDMIAFDLMKKNDVISAFKGYQGFGGYIC 68 Searching..................................................done Results from round 2 >gi|254780203|ref|YP_003064616.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] gi|254039880|gb|ACT56676.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] Length = 82 Score = 139 bits (349), Expect = 2e-31, Method: Composition-based stats. Identities = 82/82 (100%), Positives = 82/82 (100%) Query: 1 MDDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIEL 60 MDDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIEL Sbjct: 1 MDDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIEL 60 Query: 61 LKNKDFDGVEIERKSYNLRKNT 82 LKNKDFDGVEIERKSYNLRKNT Sbjct: 61 LKNKDFDGVEIERKSYNLRKNT 82 >gi|254781124|ref|YP_003065537.1| hypothetical protein CLIBASIA_05130 [Candidatus Liberibacter asiaticus str. psy62] gi|254040801|gb|ACT57597.1| hypothetical protein CLIBASIA_05130 [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Score = 98.9 bits (245), Expect = 2e-19, Method: Composition-based stats. Identities = 28/66 (42%), Positives = 46/66 (69%), Gaps = 3/66 (4%) Query: 2 DDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGY--ESYISHVCELIE 59 + +YRP ++EVR+AFP+++K++EK L + V+PL PV+ +G E Y H+C LI+ Sbjct: 12 EGNQYRPLRKEVRNAFPKILKSIEKALEPY-VDPLIEPVEIGKEGMVDEGYRLHICALIK 70 Query: 60 LLKNKD 65 LL+N+ Sbjct: 71 LLENRS 76 >gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] gi|254040866|gb|ACT57662.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] Length = 252 Score = 52.0 bits (123), Expect = 2e-05, Method: Composition-based stats. Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 6/78 (7%) Query: 3 DRKYRPSKEEVRDAFP-ELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELL 61 D KYRPS E +R P +L+K E +S + V+PL P + Y H C L+ L Sbjct: 177 DNKYRPSAEAMRTICPTKLMKIFEDTISLY-VDPL-TPRDI---SFTQYEKHACALVNWL 231 Query: 62 KNKDFDGVEIERKSYNLR 79 + F+ + I RK++N R Sbjct: 232 EKGKFNEMSIARKAFNRR 249 >gi|66820877|ref|XP_643991.1| hypothetical protein DDB_G0274829 [Dictyostelium discoideum AX4] gi|60472354|gb|EAL70307.1| hypothetical protein DDB_G0274829 [Dictyostelium discoideum AX4] Length = 414 Score = 34.2 bits (77), Expect = 5.2, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 7/61 (11%) Query: 13 VRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYES------YISHVCELIELLKNKDF 66 ++D F E K LE + F+++P+ + H +G S + H +I+LLKN+ Sbjct: 174 IKDCFIEHHKILE-SIEQFNLKPVIEWCRLHREGLSSIDSSLEFKLHRLHIIQLLKNQKS 232 Query: 67 D 67 D Sbjct: 233 D 233 >gi|304397245|ref|ZP_07379124.1| peptidase T [Pantoea sp. aB] gi|304355394|gb|EFM19762.1| peptidase T [Pantoea sp. aB] Length = 409 Score = 34.2 bits (77), Expect = 5.7, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 4 RKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKG 46 YR +E+V + FP +I + + D+EP+ P++ G Sbjct: 317 NSYRNMREKV-EPFPHIIDLALQAMRDCDIEPVVKPIRGGTDG 358 Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.309 0.137 0.378 Lambda K H 0.267 0.0422 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,550,377,160 Number of Sequences: 13984884 Number of extensions: 55832342 Number of successful extensions: 117110 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 37 Number of HSP's that attempted gapping in prelim test: 117089 Number of HSP's gapped (non-prelim): 44 length of query: 82 length of database: 4,792,584,752 effective HSP length: 53 effective length of query: 29 effective length of database: 4,051,385,900 effective search space: 117490191100 effective search space used: 117490191100 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits) S2: 75 (33.5 bits)