BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780203|ref|YP_003064616.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] (82 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done >gi|254780203|ref|YP_003064616.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] gi|254039880|gb|ACT56676.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] Length = 82 Score = 125 bits (313), Expect = 2e-27, Method: Composition-based stats. Identities = 82/82 (100%), Positives = 82/82 (100%) Query: 1 MDDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIEL 60 MDDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIEL Sbjct: 1 MDDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIEL 60 Query: 61 LKNKDFDGVEIERKSYNLRKNT 82 LKNKDFDGVEIERKSYNLRKNT Sbjct: 61 LKNKDFDGVEIERKSYNLRKNT 82 >gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] gi|254040866|gb|ACT57662.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] Length = 252 Score = 108 bits (270), Expect = 2e-22, Method: Composition-based stats. Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 6/78 (7%) Query: 3 DRKYRPSKEEVRDAFP-ELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELL 61 D KYRPS E +R P +L+K E +S + V+PL P + Y H C L+ L Sbjct: 177 DNKYRPSAEAMRTICPTKLMKIFEDTISLY-VDPL-TPRDI---SFTQYEKHACALVNWL 231 Query: 62 KNKDFDGVEIERKSYNLR 79 + F+ + I RK++N R Sbjct: 232 EKGKFNEMSIARKAFNRR 249 >gi|254781124|ref|YP_003065537.1| hypothetical protein CLIBASIA_05130 [Candidatus Liberibacter asiaticus str. psy62] gi|254040801|gb|ACT57597.1| hypothetical protein CLIBASIA_05130 [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Score = 85.6 bits (210), Expect = 2e-15, Method: Composition-based stats. Identities = 28/65 (43%), Positives = 46/65 (70%), Gaps = 3/65 (4%) Query: 2 DDRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGY--ESYISHVCELIE 59 + +YRP ++EVR+AFP+++K++EK L + V+PL PV+ +G E Y H+C LI+ Sbjct: 12 EGNQYRPLRKEVRNAFPKILKSIEKALEPY-VDPLIEPVEIGKEGMVDEGYRLHICALIK 70 Query: 60 LLKNK 64 LL+N+ Sbjct: 71 LLENR 75 Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.309 0.129 0.347 Lambda K H 0.267 0.0390 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 601,934,216 Number of Sequences: 13984884 Number of extensions: 15440300 Number of successful extensions: 29885 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 29878 Number of HSP's gapped (non-prelim): 3 length of query: 82 length of database: 4,792,584,752 effective HSP length: 53 effective length of query: 29 effective length of database: 4,051,385,900 effective search space: 117490191100 effective search space used: 117490191100 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 75 (33.6 bits)