RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780203|ref|YP_003064616.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] (82 letters) >1j09_A Glutamyl-tRNA synthetase; glurs-ATP-Glu complex, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLU ATP; 1.80A {Thermus thermophilus} (A:369-468) Length = 100 Score = 26.7 bits (59), Expect = 1.0 Identities = 8/52 (15%), Positives = 14/52 (26%), Gaps = 1/52 (1%) Query: 3 DRKYRPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHV 54 K + EE EL L + L+ ++ + V Sbjct: 12 SEKAQRKLEEGLPLLKELYPRLRA-QEEWTEAALEALLRGFAAEKGVKLGQV 62 >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} (A:1-102,A:293-322) Length = 132 Score = 26.8 bits (59), Expect = 1.1 Identities = 8/37 (21%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Query: 9 SKEEVRDA--FPELIKALEKGLSTFDVEPLKNPVKSH 43 ++EEV E + A+E+ + + + P K + Sbjct: 7 TQEEVESLISMDEAMNAVEEAFRLYALGKAQMPPKVY 43 >3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis tohama I, structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} (A:1-118,A:289-313) Length = 143 Score = 26.4 bits (58), Expect = 1.2 Identities = 4/37 (10%), Positives = 7/37 (18%), Gaps = 2/37 (5%) Query: 9 SKEEVRDA--FPELIKALEKGLSTFDVEPLKNPVKSH 43 + DA + L F + Sbjct: 8 DDAXIEDAVTPQAAQEVLHAAFLDFGRGSAAXQRRVR 44 >1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 helix bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} (A:1-126,A:296-350) Length = 181 Score = 25.5 bits (56), Expect = 2.4 Identities = 7/30 (23%), Positives = 7/30 (23%), Gaps = 3/30 (10%) Query: 9 SKEEVRDAFPELIKALEKGL---STFDVEP 35 V EL AL FD Sbjct: 15 HDIGVAPFIGELAAALRDDFKRWQAFDKSA 44 >2ea9_A JW2626, hypothetical protein YFJZ; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Escherichia coli} (A:) Length = 105 Score = 25.5 bits (56), Expect = 2.8 Identities = 9/30 (30%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Query: 9 SKEEVR---DAFPELIKALEKGLSTFDVEP 35 S E FP I +E L+T ++ P Sbjct: 41 SDAECPKLDVVFPHFISQIESMLTTGELNP 70 >1vls_A TAR, aspartate receptor; chemotaxis, bacterial chemotaxis receptor, unbound; 1.85A {Salmonella typhimurium} (A:) Length = 146 Score = 25.2 bits (55), Expect = 3.0 Identities = 9/37 (24%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Query: 32 DVEPLKNPVKSHGKGYESYISHVCELIELLKNKDFDG 68 + V + Y+ Y + + ELI+ L N + D Sbjct: 81 AMAEASANVD---EKYQRYQAALAELIQFLDNGNMDA 114 >1fw8_A PGK P72, phosphoglycerate kinase; phosphotransferase, glycolysis, mutant, permutation, permuted sequence, protein folding; 2.30A {Saccharomyces cerevisiae} (A:132-346) Length = 215 Score = 25.3 bits (55), Expect = 3.1 Identities = 12/37 (32%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Query: 46 GYESYISHVCE----LIELLKNKDFDGVEIERKSYNL 78 G ISHV +ELL+ K+ GV + +L Sbjct: 179 GVTDKISHVSTGGGASLELLEGKELPGVAFLSEKKSL 215 >1vpr_A Luciferase; beta barrel, fatty acid binding protein, lipocalin, PH regulation, luminescent protein; 1.80A {Lingulodinium polyedrum} (A:) Length = 374 Score = 24.9 bits (54), Expect = 4.3 Identities = 12/37 (32%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Query: 30 TFDVEPLKNPVKSHGKGYESYISHVCELIEL-LKNKD 65 F + L P + GK +ES ++ E EL KN Sbjct: 37 EFHEDGLHKPXEVGGKKFESGFHYLLECHELGGKNAS 73 >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} (A:1-167) Length = 167 Score = 24.6 bits (52), Expect = 4.4 Identities = 6/39 (15%), Positives = 13/39 (33%), Gaps = 7/39 (17%) Query: 1 MDDRKYRPSK-------EEVRDAFPELIKALEKGLSTFD 32 M+D RP E ++ ++A + + Sbjct: 1 MEDLALRPKTLDEYIGQERLKQKLRVYLEAAKARKEPLE 39 >2fp4_B Succinyl-COA ligase [GDP-forming] beta-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} (B:1-18,B:110-243) Length = 152 Score = 24.1 bits (52), Expect = 6.7 Identities = 14/68 (20%), Positives = 23/68 (33%), Gaps = 4/68 (5%) Query: 8 PSKEEVRDAFPELIKAL----EKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELLKN 63 EEV + PELI +G+ + + + G + +L L Sbjct: 47 VDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLK 106 Query: 64 KDFDGVEI 71 D VE+ Sbjct: 107 IDATQVEV 114 >1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} (A:68-170) Length = 103 Score = 23.9 bits (52), Expect = 7.4 Identities = 14/81 (17%), Positives = 29/81 (35%), Gaps = 15/81 (18%) Query: 8 PSKEEVRDAFPELIKALEKGLSTFDVEPL---KNPVKSH-----GKGYESYISHVCELIE 59 P + R+ +E+ + + L + PV S K + +I + Sbjct: 13 PQEPSARE---VARAYVEEVVRLEKLTVLGWREVPVNSDVLGIQAKNNQPHIEQIL---- 65 Query: 60 LLKNKDFDGVEIERKSYNLRK 80 + + G E++R+ Y R Sbjct: 66 VTCPEGCAGDELDRRLYIARS 86 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.313 0.135 0.381 Gapped Lambda K H 0.267 0.0585 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 636,608 Number of extensions: 24944 Number of successful extensions: 86 Number of sequences better than 10.0: 1 Number of HSP's gapped: 86 Number of HSP's successfully gapped: 17 Length of query: 82 Length of database: 4,956,049 Length adjustment: 46 Effective length of query: 36 Effective length of database: 3,401,019 Effective search space: 122436684 Effective search space used: 122436684 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 50 (23.4 bits)