RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780203|ref|YP_003064616.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] (82 letters) >2ea9_A JW2626, hypothetical protein YFJZ; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Escherichia coli} SCOP: d.110.8.1 PDB: 2jn7_A Length = 105 Score = 28.1 bits (63), Expect = 0.49 Identities = 9/30 (30%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Query: 9 SKEEVRD---AFPELIKALEKGLSTFDVEP 35 S E FP I +E L+T ++ P Sbjct: 41 SDAECPKLDVVFPHFISQIESMLTTGELNP 70 >3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, alter splicing, cell junction, cell membrane, endoplasmic reticul glycoprotein; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 2wjw_A* 2wjx_A Length = 376 Score = 27.9 bits (61), Expect = 0.63 Identities = 7/57 (12%), Positives = 13/57 (22%) Query: 13 VRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELLKNKDFDGV 69 DA + +A + E+ LK +G+ Sbjct: 276 TYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGL 332 >2inw_A Putative structural protein; Q83JN9 X-RAY NESG SFR137, structural genomics, PSI-2, protein structure initiative; 1.50A {Shigella flexneri} SCOP: d.110.8.1 PDB: 2h28_A Length = 133 Score = 27.8 bits (62), Expect = 0.65 Identities = 10/30 (33%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Query: 9 SKEEVRD---AFPELIKALEKGLSTFDVEP 35 S + AFP L+K LE L+ ++ P Sbjct: 55 SDVDAYHLDQAFPLLMKQLELMLTGGELNP 84 >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Length = 322 Score = 27.8 bits (61), Expect = 0.67 Identities = 8/37 (21%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Query: 9 SKEEVRDA--FPELIKALEKGLSTFDVEPLKNPVKSH 43 ++EEV E + A+E+ + + + P K + Sbjct: 7 TQEEVESLISMDEAMNAVEEAFRLYALGKAQMPPKVY 43 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 26.4 bits (58), Expect = 1.7 Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 12/54 (22%) Query: 14 RDAFPELIKALEKGLSTFDVEPLKNPV---------KSHGKGYESYISHVCELI 58 A + K L K +F+ + ++ PV + S + + I Sbjct: 433 VPASDLINKDLVKNNVSFNAKDIQIPVYDTFDGSDLRVLS---GSISERIVDCI 483 >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Length = 222 Score = 25.5 bits (54), Expect = 3.0 Identities = 11/58 (18%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 13 VRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHVCELIELLKNK--DFDG 68 V D ++ G T + S + +S +L++L+ N +F+G Sbjct: 162 VGDTDADIEAGKRAGTKTALALWGYVKLNSQIPDF--TLSRPSDLVKLMDNHIVEFEG 217 >2d4u_A Methyl-accepting chemotaxis protein I; helix-turn-helix, signaling protein; 1.95A {Escherichia coli} Length = 176 Score = 25.2 bits (55), Expect = 3.5 Identities = 12/66 (18%), Positives = 27/66 (40%), Gaps = 5/66 (7%) Query: 8 PSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHG-----KGYESYISHVCELIELLK 62 + E+ ++ +K EK + ++ P + + Y+ Y + + ELI+LL Sbjct: 65 STVAELMESASISLKQAEKNWADYEALPRDPRQSTAAAAEIKRNYDIYHNALAELIQLLG 124 Query: 63 NKDFDG 68 + Sbjct: 125 AGKINE 130 >1vls_A TAR, aspartate receptor; chemotaxis, bacterial chemotaxis receptor, unbound; 1.85A {Salmonella typhimurium} SCOP: a.24.2.1 PDB: 1vlt_A 1was_A 1wat_A 1jmw_A Length = 146 Score = 24.8 bits (54), Expect = 4.6 Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 45 KGYESYISHVCELIELLKNKDFDG 68 + Y+ Y + + ELI+ L N + D Sbjct: 91 EKYQRYQAALAELIQFLDNGNMDA 114 >1vpr_A Luciferase; beta barrel, fatty acid binding protein, lipocalin, PH regulation, luminescent protein; 1.80A {Lingulodinium polyedrum} SCOP: b.60.1.7 Length = 374 Score = 24.1 bits (52), Expect = 7.4 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Query: 30 TFDVEPLKNPVKSHGKGYESYISHVCELIEL-LKNKD 65 F + L P++ GK +ES ++ E EL KN Sbjct: 37 EFHEDGLHKPMEVGGKKFESGFHYLLECHELGGKNAS 73 >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein structure initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 Score = 23.9 bits (51), Expect = 8.5 Identities = 4/17 (23%), Positives = 10/17 (58%) Query: 56 ELIELLKNKDFDGVEIE 72 + +L+ + + GV I+ Sbjct: 102 NIYDLVSTRGYGGVTID 118 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.313 0.135 0.381 Gapped Lambda K H 0.267 0.0460 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 735,915 Number of extensions: 30014 Number of successful extensions: 128 Number of sequences better than 10.0: 1 Number of HSP's gapped: 128 Number of HSP's successfully gapped: 14 Length of query: 82 Length of database: 5,693,230 Length adjustment: 50 Effective length of query: 32 Effective length of database: 4,481,030 Effective search space: 143392960 Effective search space used: 143392960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 50 (23.7 bits)