RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780204|ref|YP_003064617.1| hypothetical protein CLIBASIA_00445 [Candidatus Liberibacter asiaticus str. psy62] (180 letters) >gnl|CDD|39447 KOG4246, KOG4246, KOG4246, Predicted DNA-binding protein, contains SAP domain [General function prediction only]. Length = 1194 Score = 29.4 bits (65), Expect = 0.63 Identities = 11/55 (20%), Positives = 18/55 (32%), Gaps = 6/55 (10%) Query: 116 DIKYERKQVISRKAKEKDLE----ESLYQISEFAACLEHPNRYWHTDSASIGFRV 166 K K+V RK E D + E Y + + + P + S + Sbjct: 724 VKKKIIKKVEERKVAEIDNKRDGDEKKYGLPDEKKIMVVPK--KSSKSGKFDCKP 776 >gnl|CDD|36686 KOG1473, KOG1473, KOG1473, Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics, Transcription]. Length = 1414 Score = 28.9 bits (64), Expect = 0.74 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 3/74 (4%) Query: 96 ILAILLSIAIPTIEEGMTMNDIKYERKQVISRKAKEKDLEESLYQI---SEFAACLEHPN 152 LA+ S + E + ++ K ERK+++ R++ K LEE++ + +++ Sbjct: 785 WLALEESPRGVIVGEFKSESNRKQERKELLVRRSGGKQLEENICSGALSCYWPKQMDNWL 844 Query: 153 RYWHTDSASIGFRV 166 R H+ S G V Sbjct: 845 RIEHSIFQSNGVTV 858 >gnl|CDD|34577 COG4970, FimT, Tfp pilus assembly protein FimT [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 181 Score = 28.8 bits (64), Expect = 0.96 Identities = 11/16 (68%), Positives = 12/16 (75%) Query: 91 LVVTAILAILLSIAIP 106 L+V AILAIL IA P Sbjct: 16 LIVLAILAILAVIAAP 31 >gnl|CDD|37417 KOG2206, KOG2206, KOG2206, Exosome 3'-5' exoribonuclease complex, subunit PM/SCL-100 (Rrp6) [Translation, ribosomal structure and biogenesis]. Length = 687 Score = 27.7 bits (61), Expect = 1.8 Identities = 11/31 (35%), Positives = 14/31 (45%) Query: 121 RKQVISRKAKEKDLEESLYQISEFAACLEHP 151 K I + + L E L + EFA LEH Sbjct: 192 PKVWICTLGELEALPEILDSVIEFAVDLEHH 222 >gnl|CDD|39173 KOG3970, KOG3970, KOG3970, Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]. Length = 299 Score = 27.7 bits (61), Expect = 2.0 Identities = 13/45 (28%), Positives = 22/45 (48%) Query: 33 YFRHTVAETPKIMWKAFKKSSGRWQWYKKSFQYLLFFSGLSYLLF 77 Y R + + +W+A SGR Q KK +L+F L+++ Sbjct: 223 YKRRPTMDWMRRLWRAKHGGSGRPQEAKKRALFLIFLGVLAFITI 267 >gnl|CDD|144369 pfam00740, Parvo_coat, Parvovirus coat protein VP2. This protein, together with VP1 forms a capsomer. Both of these proteins are formed from the same transcript using alternative splicing. As a result, VP1 and VP2 differ only in the N-terminal region of VP1. VP2 is involved in packaging the viral DNA. Length = 522 Score = 27.7 bits (62), Expect = 2.1 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 6/34 (17%) Query: 23 LSVIVSPVYSYFRHTVAETPKIMWKAFKKSSGRW 56 S IV YS + TV K+ W+ +++S RW Sbjct: 475 DSRIVQ--YSTGQWTV----KLTWELKRRASKRW 502 >gnl|CDD|35768 KOG0548, KOG0548, KOG0548, Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones]. Length = 539 Score = 26.9 bits (59), Expect = 3.2 Identities = 10/52 (19%), Positives = 23/52 (44%) Query: 110 EGMTMNDIKYERKQVISRKAKEKDLEESLYQISEFAACLEHPNRYWHTDSAS 161 G + + E ++V + KEK+L + Y+ +F ++H + + Sbjct: 206 NGFPIIEDNTEERRVKEKAHKEKELGNAAYKKKDFETAIQHYAKALELATDI 257 >gnl|CDD|35176 COG5617, COG5617, Predicted integral membrane protein [Function unknown]. Length = 801 Score = 26.4 bits (58), Expect = 5.0 Identities = 20/92 (21%), Positives = 37/92 (40%), Gaps = 7/92 (7%) Query: 16 GGLILSFLSVIVSPVYSYFRHTVAETPKIMWKAFKKSSGRWQ------WYKKSFQYLLFF 69 ++S +++ + Y + T K + G W WY + +L ++ Sbjct: 12 LISVISLIALYGNGSYPWGIDTYGHLFKAWFLYHSLKDGNWYPPWCEYWYN-GYPFLRYY 70 Query: 70 SGLSYLLFHSASFVLSLTSACLVVTAILAILL 101 LSYL+ + +F+L V +LA LL Sbjct: 71 PPLSYLIGAALNFLLGDVVTTYAVFLMLAFLL 102 >gnl|CDD|34524 COG4915, XpaC, 5-bromo-4-chloroindolyl phosphate hydrolysis protein [General function prediction only]. Length = 204 Score = 26.4 bits (58), Expect = 5.1 Identities = 20/91 (21%), Positives = 30/91 (32%), Gaps = 17/91 (18%) Query: 68 FFSGLSYLLFHSASFVLSLTSACLVVTAILAILLSIAIPT-----------------IEE 110 F L Y L + L++ + I + I E Sbjct: 4 FDMMLGYGLLGIVVVIFGGILFFLILKMSIGISIVIGNADEAEEYYKDKKMSKRERLHEA 63 Query: 111 GMTMNDIKYERKQVISRKAKEKDLEESLYQI 141 G+T D KY R+ + + K K LE+ L Q Sbjct: 64 GLTDKDYKYIRENLEEARQKIKRLEKLLKQE 94 >gnl|CDD|32348 COG2165, PulG, Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 149 Score = 26.2 bits (56), Expect = 5.8 Identities = 9/18 (50%), Positives = 15/18 (83%) Query: 91 LVVTAILAILLSIAIPTI 108 LVV AI+ IL ++A+P++ Sbjct: 16 LVVLAIIGILAALALPSL 33 >gnl|CDD|34575 COG4968, PilE, Tfp pilus assembly protein PilE [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 139 Score = 26.1 bits (57), Expect = 6.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Query: 91 LVVTAILAILLSIAIPT 107 ++V AI+ IL IA P+ Sbjct: 14 MIVVAIVGILALIAYPS 30 >gnl|CDD|31944 COG1758, RpoZ, DNA-directed RNA polymerase, subunit K/omega [Transcription]. Length = 74 Score = 25.6 bits (56), Expect = 7.3 Identities = 9/29 (31%), Positives = 18/29 (62%) Query: 103 IAIPTIEEGMTMNDIKYERKQVISRKAKE 131 +A PTIE+ + +YE V +++A++ Sbjct: 1 MARPTIEDLLDKVGNRYELVVVAAKRARQ 29 >gnl|CDD|29816 cd00771, ThrRS_core, Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain. ThrRS is a homodimer. It is responsible for the attachment of threonine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent formation of the enzyme bound aminoacyl-adenylate. Class II assignment is based upon its structure and the presence of three characteristic sequence motifs in the core domain.. Length = 298 Score = 25.5 bits (56), Expect = 9.2 Identities = 14/61 (22%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Query: 16 GGLILSFLSVIVSPVYSYFRHTVAETPKIMWKAFKKSSGRWQWYKKSFQYLLFFSGLSYL 75 G +I + L + + + ETP I K ++SG W Y+++ + Y Sbjct: 29 GAIIRNELEDFLRELQRKRGYQEVETPIIYNKELWETSGHWDHYREN-MFPFEEEDEEYG 87 Query: 76 L 76 L Sbjct: 88 L 88 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.325 0.136 0.410 Gapped Lambda K H 0.267 0.0718 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,153,863 Number of extensions: 106748 Number of successful extensions: 532 Number of sequences better than 10.0: 1 Number of HSP's gapped: 530 Number of HSP's successfully gapped: 45 Length of query: 180 Length of database: 6,263,737 Length adjustment: 88 Effective length of query: 92 Effective length of database: 4,362,145 Effective search space: 401317340 Effective search space used: 401317340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 54 (24.6 bits)