RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780204|ref|YP_003064617.1| hypothetical protein CLIBASIA_00445 [Candidatus Liberibacter asiaticus str. psy62] (180 letters) >gnl|CDD|129792 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminases. This family consists of L-diaminobutyric acid transaminases. This general designation covers both 2.6.1.76 (diaminobutyrate-2-oxoglutarate transaminase, which uses glutamate as the amino donor in DABA biosynthesis), and 2.6.1.46 (diaminobutyrate--pyruvate transaminase, which uses alanine as the amino donor). Most members with known function are 2.6.1.76, and at least some annotations as 2.6.1.46 in current databases at time of model revision are incorrect. A distinct branch of this family contains examples of 2.6.1.76 nearly all of which are involved in ectoine biosynthesis. A related enzyme is 4-aminobutyrate aminotransferase (EC 2.6.1.19), also called GABA transaminase. These enzymes all are pyridoxal phosphate-containing class III aminotransferase. Length = 442 Score = 27.2 bits (60), Expect = 2.3 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 8/52 (15%) Query: 20 LSFLSVIVSPVYSYFRHTVAETPKIMWKAFKKSSGRWQWYKKSFQYLLFFSG 71 LS + + S V SY P+ + AF K+ G W + +YL F +G Sbjct: 4 LSRQNEMESNVRSY--------PRKLPTAFAKAQGCWVTDVEGKEYLDFLAG 47 >gnl|CDD|184571 PRK14214, PRK14214, camphor resistance protein CrcB; Provisional. Length = 118 Score = 26.0 bits (57), Expect = 5.5 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 2/69 (2%) Query: 16 GGLILSFL-SVIVSPVYSYFRHTVAETPKIMWKAFKKSSGRWQWYKKSFQYLLFFSGLSY 74 G +L FL S + PV+ F T + FK S +W K +++ L + G +Y Sbjct: 45 GSFLLGFLVSSALGPVWQLFLGTGFMGGYTTFSTFKVESMELKW-KTNYRVLFSYLGCTY 103 Query: 75 LLFHSASFV 83 + A+F+ Sbjct: 104 VFGLIAAFL 112 >gnl|CDD|182560 PRK10574, PRK10574, putative major pilin subunit; Provisional. Length = 146 Score = 26.1 bits (58), Expect = 5.7 Identities = 10/16 (62%), Positives = 13/16 (81%) Query: 91 LVVTAILAILLSIAIP 106 +VV AI+AIL +I IP Sbjct: 13 MVVIAIIAILSAIGIP 28 >gnl|CDD|163494 TIGR03782, Bac_Flav_CT_J, Bacteroides conjugative transposon TraJ protein. Members of this protein family are designated TraM and are found in a proposed transfer region of a class of conjugative transposon found in the Bacteroides lineage. This family is related conjugation system proteins in the Proteobacteria, including TrbL of Agrobacterium Ti plasmids and VirB6. Length = 322 Score = 25.4 bits (56), Expect = 7.4 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 4/48 (8%) Query: 60 KKSFQYLLFFSGLSYLLFHSASFVL-SLTSACLVVTAILA-ILLSIAI 105 KKS + +F L LLF +A+ V+ +L + L+V +IL I +I++ Sbjct: 161 KKSVR--DWFRELLELLFQAAALVIDTLRTFFLIVLSILGPIAFAISV 206 >gnl|CDD|172366 PRK13839, PRK13839, conjugal transfer protein TrbG; Provisional. Length = 277 Score = 25.1 bits (55), Expect = 9.4 Identities = 10/37 (27%), Positives = 16/37 (43%) Query: 82 FVLSLTSACLVVTAILAILLSIAIPTIEEGMTMNDIK 118 L+L + CLV + L + + MT N+ K Sbjct: 2 TGLTLAAGCLVALVVPFGALLSSRALAAQSMTANEAK 38 >gnl|CDD|183089 PRK11337, PRK11337, DNA-binding transcriptional repressor RpiR; Provisional. Length = 292 Score = 25.1 bits (55), Expect = 9.5 Identities = 8/40 (20%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Query: 96 ILAILLSIAIPTIEEGMTMNDIK-YERKQVISRKAKEKDL 134 ++ + + ++ IEE ++ D+ + R +A+++DL Sbjct: 106 VVNKVFNTSLQAIEETQSILDVDEFHRAARFFYQARQRDL 145 >gnl|CDD|184143 PRK13561, PRK13561, putative diguanylate cyclase; Provisional. Length = 651 Score = 25.1 bits (55), Expect = 9.8 Identities = 12/39 (30%), Positives = 24/39 (61%), Gaps = 5/39 (12%) Query: 72 LSYLLFHSAS-----FVLSLTSACLVVTAILAILLSIAI 105 L+YL+ + S FV+S S + + +L+++L++AI Sbjct: 125 LAYLVLQADSFRMYKFVMSALSTLVTIYLLLSLILTVAI 163 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.325 0.136 0.410 Gapped Lambda K H 0.267 0.0680 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,842,711 Number of extensions: 167690 Number of successful extensions: 550 Number of sequences better than 10.0: 1 Number of HSP's gapped: 549 Number of HSP's successfully gapped: 34 Length of query: 180 Length of database: 5,994,473 Length adjustment: 87 Effective length of query: 93 Effective length of database: 4,114,577 Effective search space: 382655661 Effective search space used: 382655661 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 54 (24.7 bits)