RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780204|ref|YP_003064617.1| hypothetical protein CLIBASIA_00445 [Candidatus Liberibacter asiaticus str. psy62] (180 letters) >d2pila_ d.24.1.1 (A:) Pilin Gc {Neisseria gonorrhoeae [TaxId: 485]} Length = 158 Score = 30.4 bits (67), Expect = 0.083 Identities = 7/16 (43%), Positives = 13/16 (81%) Query: 91 LVVTAILAILLSIAIP 106 ++V AI+ IL ++A+P Sbjct: 7 MIVIAIVGILAAVALP 22 >d1lp3a_ b.121.5.2 (A:) Dependovirus capsid protein {Adeno-associated virus, aav-2 [TaxId: 272636]} Length = 519 Score = 24.9 bits (54), Expect = 3.9 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 6/36 (16%) Query: 21 SFLSVIVSPVYSYFRHTVAETPKIMWKAFKKSSGRW 56 F S I YS + +V +I W+ K++S RW Sbjct: 449 KFASFITQ--YSTGQVSV----EIEWELQKENSKRW 478 >d1t1ua1 c.43.1.3 (A:20-401) Choline O-acetyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 382 Score = 24.2 bits (52), Expect = 6.3 Identities = 8/24 (33%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Query: 58 WYKKSFQYLLFFSGLSYLLF-HSA 80 WY KS Q+++ G ++ HS Sbjct: 294 WYDKSLQFVVGRDGTCGVVCEHSP 317 >d1xl7a1 c.43.1.3 (A:11-392) Peroxisomal carnitine O-octanoyltransferase, COT {Mouse (Mus musculus) [TaxId: 10090]} Length = 382 Score = 24.2 bits (52), Expect = 7.7 Identities = 6/23 (26%), Positives = 11/23 (47%), Gaps = 1/23 (4%) Query: 58 WYKKSFQYLLFFSGLSYLLF-HS 79 W KS+ + F +G+ H+ Sbjct: 296 WGDKSYNLISFANGIFGCCCDHA 318 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.325 0.136 0.410 Gapped Lambda K H 0.267 0.0446 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 660,324 Number of extensions: 27768 Number of successful extensions: 90 Number of sequences better than 10.0: 1 Number of HSP's gapped: 90 Number of HSP's successfully gapped: 7 Length of query: 180 Length of database: 2,407,596 Length adjustment: 80 Effective length of query: 100 Effective length of database: 1,309,196 Effective search space: 130919600 Effective search space used: 130919600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.7 bits)