HHsearch alignment for GI: 254780205 and conserved domain: KOG1381

>KOG1381 consensus.
Probab=100.00  E-value=0  Score=520.23  Aligned_cols=290  Identities=34%  Similarity=0.525  Sum_probs=278.6

Q ss_pred             CCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             05467789999863048531599899999999985212343344564216999999999999998999999641388778
Q gi|254780205|r   14 IMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDID   93 (310)
Q Consensus        14 ~~~~~i~~Y~~L~R~~kp~g~~ll~~p~~~~~~la~~~~~~~~~~~~~~~~~~l~l~~~G~~~~r~ag~~~Nd~~D~diD   93 (310)
T Consensus        59 ~~p~r~~pYaqLmRldkPiGTwLLywPCtWSIamaA-------dag~~p~~~mL~LFG~GAllMRgAGCtINDlwDkdlD  131 (353)
T KOG1381          59 SSPKRWKPYAQLMRLDKPIGTWLLYWPCTWSIAMAA-------DAGLLPSIKMLALFGVGALLMRGAGCTINDLWDKDLD  131 (353)
T ss_pred             CCCCCCHHHHHHHHCCCCCEEEEEECCHHHHHHHCC-------CCCCCCHHHHHHHHCCCHHHHCCCCCEEHHHHHHHHH
T ss_conf             387223259999714787610354320177888606-------9876502689998550087710688540265531466


Q ss_pred             CCCCCCCCHHHHCCCCCHHHCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             43423431010012332101100134431000345554444432100356544431166555543320010100145663
Q gi|254780205|r   94 SQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVF  173 (310)
Q Consensus        94 ~~~~RT~~RPl~sG~is~~~A~~~~~~l~~l~~~~~~~ln~~~~~l~~~~~~~~~iYp~~KR~t~~p~~~lG~~~~~~~l  173 (310)
T Consensus       132 ~KVeRtklRPlAsG~ls~~qaI~fL~~ql~~gLgiLlqLn~ysi~lg~~sl~~v~~ypl~kr~TY~pq~vLgltfnwGAl  211 (353)
T KOG1381         132 AKVERTKLRPLASGSLSPRQAIGFLGAQLSLGLGILLQLNWYSIALGASSLALVITYPLMKRFTYWPQLVLGLTFNWGAL  211 (353)
T ss_pred             HHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCHHHHHHCCCCCCCEEEEEHHHHCCHHHHHHHHHHCCHHHH
T ss_conf             66765323533358756557789999999876799972668889852245240777412220232078897622133545


Q ss_pred             HCCCCCCCCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             011145754320-2468888874210035799888753100025720346654202046665337899999999999835
Q gi|254780205|r  174 VGWGALHASFSW-PAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLT  252 (310)
Q Consensus       174 ~g~~av~g~~~~-~~~~L~~~~~~Wt~~~dtiYa~~D~edD~k~GikSlav~~G~~~~~~i~~~~~~~~~~~~~~~~~~~  252 (310)
T Consensus       212 lGw~A~~g~~~~s~~~plYls~v~Wtl~YDTIYAHQDK~dDvk~gvkSTALrfG~nTK~wl~gf~a~~ia~La~aG~~s~  291 (353)
T KOG1381         212 LGWCALKGSLSPSAVLPLYLSGVCWTLIYDTIYAHQDKRDDVKIGVKSTALRFGDNTKPWLSGFGAAQIASLAAAGIASD  291 (353)
T ss_pred             HCCHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             26464427647024268998413233212346650341453674214655440778716776403989999987443058


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             3379999999999999999998089997999999876459999999999999865219
Q gi|254780205|r  253 VNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF  310 (310)
Q Consensus       253 ~~~~~~~~~l~~~~~l~~~i~~~~~~~~~~~~k~Fk~n~~~g~ii~~~iild~lL~~~  310 (310)
T Consensus       292 q~~pyy~~lg~~~~~L~~~i~~vdiDnp~dC~k~f~sN~ntGli~~~~i~~d~llk~~  349 (353)
T KOG1381         292 QTWPYYAALGAVAARLGSQIYKVDIDNPSDCWKKFKSNSNTGLILFSGIVLDTLLKSF  349 (353)
T ss_pred             CCCHHHHHHHHHHHHHHHHEEEEECCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             8851788899999998764034446881889999886576248898999999999886