HHsearch alignment for GI: 254780205 and conserved domain: PRK12871

>PRK12871 ubiA prenyltransferase; Reviewed.
Probab=100.00  E-value=0  Score=416.27  Aligned_cols=280  Identities=17%  Similarity=0.178  Sum_probs=226.7

Q ss_pred             CCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             54677899998630485315998999999999852123433445642169999999999999989999996413887784
Q gi|254780205|r   15 MGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDS   94 (310)
Q Consensus        15 ~~~~i~~Y~~L~R~~kp~g~~ll~~p~~~~~~la~~~~~~~~~~~~~~~~~~l~l~~~G~~~~r~ag~~~Nd~~D~diD~   94 (310)
T Consensus         1 m~e~l~ayi~LtR~~-----~ll~WP~lw~~~Lal~~a~-----~g~~~~~~l~if~Lg~vlmrsAGCviNDyaDR~~D~   70 (297)
T PRK12871          1 MKETLKAYIDLTRAH-----FLPAWPLLFCSGLVLAFAN-----YGGFSWELTIKAALIGLFGFEAGFVLNDYVDRKRDR   70 (297)
T ss_pred             CHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHC-----CCCCCHHHHHHHHHHHHHHHHCCCEEHHHHHHCCCH
T ss_conf             946899999999883-----9988899998799999864-----699976799999999999970575110034310220


Q ss_pred             C-CCCC--------CCHHHHCCCCCHHHCCCHHHHHHHHHCCCCCCC----CCCCCCCHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             3-4234--------310100123321011001344310003455544----44432100356544431166555543320
Q gi|254780205|r   95 Q-VLRT--------RSRPLPSGQCTRFQALVFAVLQFLISFVLLLQF----NPFVICVGFALLFISLLYPFSKRFILCPQ  161 (310)
Q Consensus        95 ~-~~RT--------~~RPl~sG~is~~~A~~~~~~l~~l~~~~~~~l----n~~~~~l~~~~~~~~~iYp~~KR~t~~p~  161 (310)
T Consensus        71 ~~ve~~v~r~~r~~k~RPLpsG~vs~keAl~lf~~L~~~~~~LvL~Lp~~~~~~~~~~~l~A~~la~~YPfmKR~t~~Pq  150 (297)
T PRK12871         71 LDVENTLTRYWRPFKERPIPSGKLSSKNAFALFILLAAVTSALILTLPYPNSLYVFVIMLYSYGIEAFYQVKKRNQKYPV  150 (297)
T ss_pred             HHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCH
T ss_conf             10244210025665689799888688999999999999999999983253079999999999999999898853660329


Q ss_pred             HHH--HHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCHHHHHHHHHHH
Q ss_conf             010--100145663011145754320246888887421003579988875310002572034665420204666533789
Q gi|254780205|r  162 VVL--GIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGI  239 (310)
Q Consensus       162 ~~l--G~~~~~~~l~g~~av~g~~~~~~~~L~~~~~~Wt~~~dtiYa~~D~edD~k~GikSlav~~G~~~~~~i~~~~~~  239 (310)
T Consensus       151 a~L~g~~~f~~~p~a~a-a~~G~~~~~~~Ll~~~~l~WTvAYDT~Yam~DredDlkiGvKStAILFG~k~~~~~i~~~~~  229 (297)
T PRK12871        151 AQLLGRTDFTLFPAAGY-LCYGQPDMTALLYMVFFYPWTMAHLGLNDFIDLENDRARGMKSIAVLYGMKGTMYWVTGFTA  229 (297)
T ss_pred             HHHHHHHHHHHHHHHHH-HHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCCCHHHHHHHCCCCHHHHHHHHHH
T ss_conf             99999998757899999-98199878999999999999999999998714215485283032212167633799999999


Q ss_pred             HHHHHHHHHHHHCCCHHH-HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999983533799-9999999999999999808999799999987645999999999999986
Q gi|254780205|r  240 FVLCFMVAFCLLTVNFFA-WIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF  306 (310)
Q Consensus       240 ~~~~~~~~~~~~~~~~~~-~~~~l~~~~~l~~~i~~~~~~~~~~~~k~Fk~n~~~g~ii~~~iild~l  306 (310)
T Consensus       230 l~~~~~l~-~~~~~~~~~l~~~~~g~~ll~~~~~~l~~~~~~~~~~~a~~~~h~~~~~~~~~~~~~~~  296 (297)
T PRK12871        230 LHFLAAIF-FLRELGPIALYGFLAGFVLLAGANLYLWKEKSQDAGMKILPLYHASLVIYAVSIILDFI  296 (297)
T ss_pred             HHHHHHHH-HHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99999999-99752637699999999999999999975258551788888875426777588677520