HHsearch alignment for GI: 254780205 and conserved domain: PRK12873

>PRK12873 ubiA prenyltransferase; Reviewed.
Probab=100.00  E-value=0  Score=548.95  Aligned_cols=284  Identities=29%  Similarity=0.474  Sum_probs=260.4

Q ss_pred             HCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             10546778999986304853159989999999998521234334456421699999999999999899999964138877
Q gi|254780205|r   13 CIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDI   92 (310)
Q Consensus        13 ~~~~~~i~~Y~~L~R~~kp~g~~ll~~p~~~~~~la~~~~~~~~~~~~~~~~~~l~l~~~G~~~~r~ag~~~Nd~~D~di   92 (310)
T Consensus         4 ~~~~~kl~~y~~L~RldkP~G~~LLl~P~~~~l~la~~~~---------p~~~~l~lf~~G~~~mRsagC~iNDi~Drdi   74 (297)
T PRK12873          4 KSRSIKLSPWFELLRWNKPTGRLILLIPAGWSLWLTPSAP---------PSLLLLLLIILGGLAVSGAGCIANDLWDRRI   74 (297)
T ss_pred             CCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCC---------CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             5277758999999811136989999998999999856799---------9789999999999999875539987899662


Q ss_pred             CCCCCCCCCHHHHCCCCCHHHCCCHHHHHHHHHCCCCCCCCC----CCCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHH
Q ss_conf             843423431010012332101100134431000345554444----4321003565444311665555433200101001
Q gi|254780205|r   93 DSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP----FVICVGFALLFISLLYPFSKRFILCPQVVLGIGF  168 (310)
Q Consensus        93 D~~~~RT~~RPl~sG~is~~~A~~~~~~l~~l~~~~~~~ln~----~~~~l~~~~~~~~~iYp~~KR~t~~p~~~lG~~~  168 (310)
T Consensus        75 D~~v~RTk~RPLasG~vS~~~A~~~~~~l~~~~~~ll~~l~~~~~~~~l~la~~~~~~i~~YPl~KR~t~~PQ~~LG~~f  154 (297)
T PRK12873         75 DRKVERTKNRPLARGKISLKTAYSLLIVLLLLSLFVVLSLPQPSRNLCLSLAFLALPPILIYPSAKRWFAYPQAILALCW  154 (297)
T ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             13654256775235785386899999999999999999965048999999999999999998776553104589999999


Q ss_pred             HHHHHHCCCCCCCCCCHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHH
Q ss_conf             4566301114575432024688--88874210035799888753100025720346654202046665337899999999
Q gi|254780205|r  169 AGGVFVGWGALHASFSWPAFFL--CIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV  246 (310)
Q Consensus       169 ~~~~l~g~~av~g~~~~~~~~L--~~~~~~Wt~~~dtiYa~~D~edD~k~GikSlav~~G~~~~~~i~~~~~~~~~~~~~  246 (310)
T Consensus       155 ~~~~l~~waav~g~l~~~~~ll~~~l~~~~Wt~~yDtiYA~qD~~dD~k~GvkS~av~fG~~~~~~i~~~~~l~~~ll~~  234 (297)
T PRK12873        155 GFAVLIPWAAAEGSLNGGWPLLFCWLATLLWTFGFDTVYAMADRRDDAKIGLNSSALSLGSNALKTVQICYFLTSIFLAL  234 (297)
T ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHCCCCCCHHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             98899999998088871599999999999999999999997249879976986505776504199999999999999999


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99983533799999999999999999980899--979999998764599999999999998
Q gi|254780205|r  247 AFCLLTVNFFAWIGLLIALFLTIKRIIALDIS--CSKQCCSFFHSAGVVGILILICLIISL  305 (310)
Q Consensus       247 ~~~~~~~~~~~~~~~l~~~~~l~~~i~~~~~~--~~~~~~k~Fk~n~~~g~ii~~~iild~  305 (310)
T Consensus       235 ~g~~~~~~~~yy~~~li~~~~~~~~~~~l~~~~~~~~~~~~~F~~N~~~G~llf~Givl~k  295 (297)
T PRK12873        235 AAFIAQVGFIFWPFWLIASIGMQRDILKLFPEKQSIKTIGNHFSNQVILGSLLLLGLILAR  295 (297)
T ss_pred             HHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9998618799999999999999999999616676768999999987999999999999618