HHsearch alignment for GI: 254780205 and conserved domain: PRK12883

>PRK12883 ubiA prenyltransferase UbiA-like protein; Reviewed.
Probab=100.00  E-value=0  Score=317.07  Aligned_cols=270  Identities=16%  Similarity=0.213  Sum_probs=221.5

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             77899998630485315998999999999852123433445642169999999999999989999996413887784342
Q gi|254780205|r   18 AIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVL   97 (310)
Q Consensus        18 ~i~~Y~~L~R~~kp~g~~ll~~p~~~~~~la~~~~~~~~~~~~~~~~~~l~l~~~G~~~~r~ag~~~Nd~~D~diD~~~~   97 (310)
T Consensus         2 ~lk~yleL~R---p~n~~~a~~~~~~g~~ia~~~~~---------~~~~~~l~~l~~~~~~aag~~iND~~D~eiD~iN~   69 (275)
T PRK12883          2 EVKAFIEIMR---PHNCILAGIVGILGSLVAYEGIP---------DIKTLILIFLVVYLGCSGGNTINDYFDYEIDKINR   69 (275)
T ss_pred             CHHHHHHHHH---HHHHHHHHHHHHHHHHHHCCCCC---------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             6899999972---87789999999999999846899---------78999999999999999999998588884054558


Q ss_pred             CCCCHHHHCCCCCHHHCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCC-CCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             3431010012332101100134431000345554444432100356544431166-555543320010100145663011
Q gi|254780205|r   98 RTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPF-SKRFILCPQVVLGIGFAGGVFVGW  176 (310)
Q Consensus        98 RT~~RPl~sG~is~~~A~~~~~~l~~l~~~~~~~ln~~~~~l~~~~~~~~~iYp~-~KR~t~~p~~~lG~~~~~~~l~g~  176 (310)
T Consensus        70 --p~RPipsG~IS~~~A~~~~~~l~~~g~~l~~~ln~~~~~l~~~~~~l~~~Ys~~lK~~~l~gNi~va~~~g~~~l~g~  147 (275)
T PRK12883         70 --PNRPLPRGAMSRKAALYYSVLQYAIGLALAYFLNIWAFLFALIAYVLTFIYAWKLKPLPFIGNVVVALLTAATPIYGA  147 (275)
T ss_pred             --CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             --999887776689999999999999999999997399999999999999998998665885599999999999999999


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCCHH
Q ss_conf             14575432024688888742100357998887531000257203466542020466653378999999999998353379
Q gi|254780205|r  177 GALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF  256 (310)
Q Consensus       177 ~av~g~~~~~~~~L~~~~~~Wt~~~dtiYa~~D~edD~k~GikSlav~~G~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~  256 (310)
T Consensus       148 ~a~-g~~~~-~~~l~~~afl~~l~reivkdieD~egD~~~G~~TlPi~~G~~~a~~ia~~~~~l~~~~s~lp~~~g~~~~  225 (275)
T PRK12883        148 VGV-GRIGL-AGYLAICAFLVNVSREIMKDIEDIEGDMAKGAKTLPIIIGKKRAAYIGAIFGFLTVIASFLPVKVGIGLG  225 (275)
T ss_pred             HHH-CCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             995-75409-9999999999999999999999861098769957378946797999999999999999999999977399


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999808999-799999987645999999999999986
Q gi|254780205|r  257 AWIGLLIALFLTIKRIIALDISC-SKQCCSFFHSAGVVGILILICLIISLF  306 (310)
Q Consensus       257 ~~~~~l~~~~~l~~~i~~~~~~~-~~~~~k~Fk~n~~~g~ii~~~iild~l  306 (310)
T Consensus       226 y~~~i~v~~~~~~~~~~~~~~~~~a~~~~~~lk~~m~l~li---af~~g~l  273 (275)
T PRK12883        226 YLPIIPVDAMILKASIDVLRDPETAHKGQKLLKIATFLAVI---SFLIGAL  273 (275)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHH---HHHHHHH
T ss_conf             99999999999999999964922269999999999999999---9999773