HHsearch alignment for GI: 254780205 and conserved domain: PRK12888

>PRK12888 ubiA prenyltransferase; Reviewed.
Probab=100.00  E-value=0  Score=531.20  Aligned_cols=286  Identities=22%  Similarity=0.302  Sum_probs=269.3

Q ss_pred             CCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             05467789999863048531599899999999985212343344564216999999999999998999999641388778
Q gi|254780205|r   14 IMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDID   93 (310)
Q Consensus        14 ~~~~~i~~Y~~L~R~~kp~g~~ll~~p~~~~~~la~~~~~~~~~~~~~~~~~~l~l~~~G~~~~r~ag~~~Nd~~D~diD   93 (310)
T Consensus        22 ~~p~klr~yl~Lir~~h~if~lpf~~~~~~~a~~a~~g~---------p~~~~l~~~~lg~v~~RsAgc~iNdi~DrdiD   92 (313)
T PRK12888         22 RQPGRVRAFLRLVAIEHSVFALPFAYIAALTAMFAADRS---------VHWGDLLLVTVAMVGARTFAMAANRIIDREID   92 (313)
T ss_pred             CCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCC---------CCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             984779999999985480999999999999999861799---------99999999999999999999999977443425


Q ss_pred             CCCCCCCCHHHHCCCCCHHHCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             43423431010012332101100134431000345554444432100356544431166555543320010100145663
Q gi|254780205|r   94 SQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVF  173 (310)
Q Consensus        94 ~~~~RT~~RPl~sG~is~~~A~~~~~~l~~l~~~~~~~ln~~~~~l~~~~~~~~~iYp~~KR~t~~p~~~lG~~~~~~~l  173 (310)
T Consensus        93 ~~v~RTk~RPL~sG~is~~~A~~~~~~~~~~~~~~~~~ln~l~~~ls~~~~~~~~~Yp~~KRfT~~pq~~LG~a~~~~~l  172 (313)
T PRK12888         93 ARNPRTAGRELVTGAVSVRTAWTGALVALAVFLGAAALLNPLCLALAPLAVAPLVVYPYAKRFTNFPHAVLGLAQAVGPV  172 (313)
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             67955578876568867999999999999999999999989999999999999999999988765457999999998788


Q ss_pred             HCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCHHHHH-HHHHHHHHHHHHHHHHHHC
Q ss_conf             011145754320246888887421003579988875310002572034665420204666-5337899999999999835
Q gi|254780205|r  174 VGWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL-FILYGIFVLCFMVAFCLLT  252 (310)
Q Consensus       174 ~g~~av~g~~~~~~~~L~~~~~~Wt~~~dtiYa~~D~edD~k~GikSlav~~G~~~~~~i-~~~~~~~~~~~~~~~~~~~  252 (310)
T Consensus       173 ~~w~Av~g~~~~~~~lL~~~~~~W~~~fDtiYA~qD~edD~k~Gi~S~a~~fG~~~~l~i~~~~~~~~~~ll~~~g~~~~  252 (313)
T PRK12888        173 GAWIAVTGTWSWPAVLLGLAVGLWIGGFDLIYACQDAEVDRRIGVRSVPARFGVRAALWGSRVAHVVTFALFVWFGLATG  252 (313)
T ss_pred             HHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999728887899999999999999998987871653298749985278868502799999999999999999999973


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH-HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             33799999999999999999980899979999998-764599999999999998652
Q gi|254780205|r  253 VNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFF-HSAGVVGILILICLIISLFLD  308 (310)
Q Consensus       253 ~~~~~~~~~l~~~~~l~~~i~~~~~~~~~~~~k~F-k~n~~~g~ii~~~iild~lL~  308 (310)
T Consensus       253 l~~~y~~g~~~~~~ll~yq~~li~~~d~~~~~~aFF~~N~~vglilf~~~l~d~llr  309 (313)
T PRK12888        253 AGALWWAGLLLTAVAFAYEHRIVSPTDLSRVNRAFFTANGFIGIALFGFALGDLLVR  309 (313)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             809999999999999999999927888899999999850399999999999999975