BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780205|ref|YP_003064618.1| prenyltransferase [Candidatus
Liberibacter asiaticus str. psy62]
         (310 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780205|ref|YP_003064618.1| prenyltransferase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254039882|gb|ACT56678.1| prenyltransferase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 310

 Score =  616 bits (1589), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 310/310 (100%), Positives = 310/310 (100%)

Query: 1   MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGW 60
           MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGW
Sbjct: 1   MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGW 60

Query: 61  STIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVL 120
           STIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVL
Sbjct: 61  STIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVL 120

Query: 121 QFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALH 180
           QFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALH
Sbjct: 121 QFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALH 180

Query: 181 ASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIF 240
           ASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIF
Sbjct: 181 ASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIF 240

Query: 241 VLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILIC 300
           VLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILIC
Sbjct: 241 VLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILIC 300

Query: 301 LIISLFLDQF 310
           LIISLFLDQF
Sbjct: 301 LIISLFLDQF 310


>gi|315122630|ref|YP_004063119.1| prenyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313496032|gb|ADR52631.1| prenyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 296

 Score =  414 bits (1064), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/296 (67%), Positives = 238/296 (80%)

Query: 15  MGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGA 74
           M S  +PY +LAR H  TGW L +LP LWS + AAYPLRRAG+L WSTIFWYL  Y++G+
Sbjct: 1   MNSVFSPYAHLARLHMLTGWRLMLLPSLWSIIFAAYPLRRAGLLSWSTIFWYLCFYLIGS 60

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
           I+ R A CTWNDLVDH+IDSQV RTRSRPLP+GQC+R +A +FA+ QF+IS +LL+Q N 
Sbjct: 61  IIVRSAGCTWNDLVDHNIDSQVSRTRSRPLPAGQCSRSRAYIFAIFQFVISLILLMQLNY 120

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT 194
           FVIC+GFA+  I L+YPFSKRFI CPQVVLGI   GGVF+GWG+LH SFSW AF+L IGT
Sbjct: 121 FVICIGFAVFVILLIYPFSKRFIPCPQVVLGICCGGGVFIGWGSLHESFSWTAFWLFIGT 180

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
           IFWV++FDTVYAHQDKKDDE IG+NSTARLF+  TK+W+ ILYG+F LCFM+A  L+  N
Sbjct: 181 IFWVIHFDTVYAHQDKKDDEQIGINSTARLFADHTKIWISILYGLFTLCFMIALYLVQAN 240

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
           FFAWIGLLIALF TIKRII LDIS S QC  FF +A + G+ I   L+ SLFLDQF
Sbjct: 241 FFAWIGLLIALFFTIKRIIILDISSSDQCFLFFKTADMTGMFIFASLLFSLFLDQF 296


>gi|15964617|ref|NP_384970.1| prenyltransferase [Sinorhizobium meliloti 1021]
 gi|307309363|ref|ZP_07589026.1| 4-hydroxybenzoate polyprenyl transferase [Sinorhizobium meliloti
           BL225C]
 gi|307320099|ref|ZP_07599520.1| 4-hydroxybenzoate polyprenyl transferase [Sinorhizobium meliloti
           AK83]
 gi|15073795|emb|CAC45436.1| Probable 4-hydroxybenzoate octaprenyltransferase transmembrane
           protein [Sinorhizobium meliloti 1021]
 gi|306894314|gb|EFN25079.1| 4-hydroxybenzoate polyprenyl transferase [Sinorhizobium meliloti
           AK83]
 gi|306900232|gb|EFN30850.1| 4-hydroxybenzoate polyprenyl transferase [Sinorhizobium meliloti
           BL225C]
          Length = 318

 Score =  259 bits (661), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 141/313 (45%), Positives = 187/313 (59%), Gaps = 8/313 (2%)

Query: 1   MSQFFNFKWVRDC--------IMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPL 52
           M+ F +   V D         ++  A+ PY  LARW    GW L +LPCLWS  +AA   
Sbjct: 1   MNSFIDSGRVHDAPSNNWVYRVLPRALWPYAQLARWDRPIGWQLLLLPCLWSAAMAAGAA 60

Query: 53  RRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRF 112
              G        +++F++ VGAI  RGA CT+ND+VDHDID +V RTRSRPLPSG+ TRF
Sbjct: 61  ASLGSFSAGRFLFHIFLFTVGAIAMRGAGCTYNDIVDHDIDMEVARTRSRPLPSGRVTRF 120

Query: 113 QALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGV 172
           QA  F +LQ L+  V+LLQFN F I +GF  L +  +YPF+KRF   PQ  LG+ F+ G 
Sbjct: 121 QAKAFMLLQALVGLVVLLQFNGFTIFLGFLSLALVAIYPFAKRFTDWPQFFLGLAFSWGA 180

Query: 173 FVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLW 232
            +GW A   S S  A  L    I W + +DT+YA+QD++DDELIGV STAR F    + W
Sbjct: 181 IMGWTAEFGSLSLAAISLYAAAIAWTIGYDTIYAYQDREDDELIGVRSTARRFGDNPQPW 240

Query: 233 LFILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGV 292
           L  LYGI V   + AF      FFA++GLL+A  +   +I+ L+I    QC + F   GV
Sbjct: 241 LIGLYGIAVFLMLFAFLAAGAGFFAYVGLLVAAVMLAYQIVVLNIHDPLQCLALFKFNGV 300

Query: 293 VGILILICLIISL 305
           VG++I   L++SL
Sbjct: 301 VGLIIFAGLVLSL 313


>gi|37903514|gb|AAP56241.1| p-hydroxybenzoate decaprenyltransferase [Agrobacterium tumefaciens]
          Length = 317

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 133/295 (45%), Positives = 179/295 (60%), Gaps = 2/295 (0%)

Query: 14  IMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVG 73
           I+  ++ PY  LARW    GW L + PC WS  LAA     +G   W+T+ W+L ++ +G
Sbjct: 23  ILPRSLWPYAQLARWDRPIGWQLLMWPCFWSAALAANVAVASGGFSWATLIWHLALFFIG 82

Query: 74  AIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFN 133
           ++  RGA CT+NDL DH ID  V RTRSRPLPSG+ +R QA VF VLQ L   V+LLQFN
Sbjct: 83  SVAMRGAGCTYNDLADHKIDMAVARTRSRPLPSGRVSRMQAKVFIVLQALAGLVVLLQFN 142

Query: 134 PFVICVG-FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI 192
            F I  G F+L+F+++ YPF+KRF   PQ  LG+ F+ G  +GW     S +WPA  L +
Sbjct: 143 SFAIATGIFSLVFVAI-YPFAKRFTNWPQFFLGLAFSWGALMGWAGQFGSLAWPAVLLYV 201

Query: 193 GTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLT 252
           G+I W + +DT+YAHQDK+DD  +G+ STA LF   T  WL  LYG  +    ++F +  
Sbjct: 202 GSIAWTIGYDTIYAHQDKEDDTAVGIGSTALLFGENTHRWLVFLYGTALAMMFLSFWMAD 261

Query: 253 VNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
           VN  A+ GL  A  +  +++  LDI    QC   F S   VG+LI   LI+ L L
Sbjct: 262 VNIIAYSGLAAAALMLFRQVWVLDIDDVDQCLVLFKSNNRVGVLIFAGLILPLLL 316


>gi|150395702|ref|YP_001326169.1| 4-hydroxybenzoate polyprenyltransferase [Sinorhizobium medicae
           WSM419]
 gi|150027217|gb|ABR59334.1| 4-hydroxybenzoate polyprenyl transferase [Sinorhizobium medicae
           WSM419]
          Length = 321

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 133/294 (45%), Positives = 181/294 (61%)

Query: 14  IMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVG 73
           ++  A+ PY  LARW    GW L + PCLWS  +AA      G        +++F++IVG
Sbjct: 25  VLPRALWPYAQLARWDRPIGWQLLMWPCLWSAAMAAGAAASLGSFSAGRFLFHIFLFIVG 84

Query: 74  AIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFN 133
           AI  RGA CT+ND+VDHDID +V RTRSRPLPSG+ TRFQA  F +LQ ++   +LLQFN
Sbjct: 85  AIAMRGAGCTYNDIVDHDIDMEVARTRSRPLPSGRVTRFQAKAFMLLQSVVGLAVLLQFN 144

Query: 134 PFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIG 193
            F I +G   L +  +YPF+KRF   PQ  LG+ F+ G  +GW A   S S+    L   
Sbjct: 145 GFTIFLGVLSLALVAIYPFAKRFTDWPQFFLGLAFSWGAIMGWAAEFGSLSFAPVMLYAA 204

Query: 194 TIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTV 253
            I W + +DT+YA+QD++DDELIGV STAR F    + WL  LYGI VL  + AF     
Sbjct: 205 AITWTIGYDTIYAYQDREDDELIGVRSTARRFGDNPRPWLIGLYGIAVLLMLFAFLAAGA 264

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
            FFA++GL++A  +   +I+ L+I    QC + F   GVVG++I   L++SL +
Sbjct: 265 GFFAYLGLVVAAVMLAYQILVLNIHDPLQCLALFKFNGVVGLIIFAGLVLSLLV 318


>gi|222085076|ref|YP_002543606.1| 4-hydroxybenzoate polyprenyl transferase [Agrobacterium radiobacter
           K84]
 gi|221722524|gb|ACM25680.1| 4-hydroxybenzoate polyprenyl transferase [Agrobacterium radiobacter
           K84]
          Length = 319

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 132/284 (46%), Positives = 176/284 (61%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LARW    GW L + PC WS  LAA      G      + ++L +Y +GA+  RGA
Sbjct: 30  PYAQLARWDRPIGWQLLMWPCFWSAALAANAAAAVGQSPGFLVVYHLILYFIGAVAMRGA 89

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT+NDLVDH ID +V RTRSRPLPSG+ TRFQA VF  LQ L+  ++LLQFN F + +G
Sbjct: 90  GCTYNDLVDHKIDMEVARTRSRPLPSGRVTRFQAKVFIALQALVGLLVLLQFNWFAVILG 149

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L I  LYPF+KRF   PQ  LG+ F+ G  +GW  L  S S     L    I W + 
Sbjct: 150 VLSLAIVALYPFAKRFTDWPQFFLGLAFSWGALMGWAGLFGSLSLAPIMLYAAAILWTIG 209

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQDK+DDELIGV STARLF  +T+LWL  LYG+ ++  +++F L    + +++G
Sbjct: 210 YDTIYAHQDKEDDELIGVRSTARLFGDKTRLWLIGLYGVALVLMLLSFALAGAGWLSYVG 269

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           LL+A  +   +I  LDI+  +QC + F   G VG++I   L +S
Sbjct: 270 LLVAGGMFAYQIAVLDINNGEQCLALFKFNGKVGLIIFAGLFLS 313


>gi|327188118|gb|EGE55340.1| 4-hydroxybenzoate octaprenyltransferase protein [Rhizobium etli
           CNPAF512]
          Length = 319

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 131/285 (45%), Positives = 174/285 (61%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LARW    GW L + PC WS  LAA      GV   + +  +L +Y +GA+  RGA
Sbjct: 30  PYAQLARWDRPIGWQLLMWPCFWSATLAANAAIDKGVYSGTLLVSHLILYFIGAVAMRGA 89

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT+NDLVDH+ID QV RTRSRPLPSG+ TR  A +F  LQ L+   +LLQFN F + +G
Sbjct: 90  GCTYNDLVDHEIDMQVARTRSRPLPSGRVTRAHAKIFIGLQALVGLFVLLQFNWFTVFLG 149

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L I  LYP++KRF   PQ  LG+ F+ G  +GW  +    S+ A  L   ++ W + 
Sbjct: 150 LLSLGIVALYPYAKRFTDWPQFYLGLAFSWGALMGWAGILGGLSFAAVLLYAASVAWTIG 209

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQDK+DDELIGV STARLF  +T+ WL  LYG+ ++   VAF L   N  A++ 
Sbjct: 210 YDTIYAHQDKEDDELIGVRSTARLFGDRTRTWLIGLYGLTLVLMFVAFALAGANLIAFLA 269

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
           LL A  +   +I+ LDI  + QC + F S   VG++I   L +SL
Sbjct: 270 LLGAAGMFAWQIVRLDIEDAAQCLALFKSNNRVGLIIFFGLFVSL 314


>gi|190890607|ref|YP_001977149.1| 4-hydroxybenzoate octaprenyltransferase protein [Rhizobium etli
           CIAT 652]
 gi|190695886|gb|ACE89971.1| 4-hydroxybenzoate octaprenyltransferase protein [Rhizobium etli
           CIAT 652]
          Length = 319

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 131/285 (45%), Positives = 174/285 (61%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LARW    GW L + PC WS  LAA      GV   + +  +L +Y +GA+  RGA
Sbjct: 30  PYAQLARWDRPIGWQLLMWPCFWSATLAANAAIDKGVYSGTLLVSHLILYFIGAVAMRGA 89

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT+NDLVDH+ID QV RTRSRPLPSG+ TR  A +F  LQ L+   +LLQFN F + +G
Sbjct: 90  GCTYNDLVDHEIDMQVARTRSRPLPSGRVTRAHAKIFIGLQALVGLFVLLQFNWFTVFLG 149

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L I  LYP++KRF   PQ  LG+ F+ G  +GW  +    S+ A  L   ++ W + 
Sbjct: 150 LLSLGIVALYPYAKRFTDWPQFYLGLAFSWGALMGWAGILGGLSFAAVLLYAASVAWTIG 209

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQDK+DDELIGV STARLF  +T+ WL  LYG+ ++   VAF L   N  A++ 
Sbjct: 210 YDTIYAHQDKEDDELIGVRSTARLFGDRTRTWLIGLYGLTLVLMFVAFALAGANLIAFLA 269

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
           LL A  +   +I+ LDI  + QC + F S   VG++I   L +SL
Sbjct: 270 LLGAAGMFAWQIVRLDIEDAAQCLALFKSNNRVGLIIFFGLFVSL 314


>gi|15887993|ref|NP_353674.1| prenyltransferase [Agrobacterium tumefaciens str. C58]
 gi|15155603|gb|AAK86459.1| 4-hydroxybenzoate octaprenyltransferase [Agrobacterium tumefaciens
           str. C58]
          Length = 317

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 129/294 (43%), Positives = 172/294 (58%)

Query: 14  IMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVG 73
           I+   + PY  LARW    GW L + PC W+  LAA      G   W T+ W+L ++ +G
Sbjct: 23  ILPRPLWPYAQLARWDRPIGWQLLMWPCFWAAALAANAAVATGGFSWGTLIWHLVLFFIG 82

Query: 74  AIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFN 133
           ++  RGA CT+NDL DH ID  V RTRSRPLPSG+ +R QA +F VLQ L   V+LLQFN
Sbjct: 83  SVAMRGAGCTYNDLADHKIDMAVARTRSRPLPSGRVSRGQAKLFIVLQALAGLVVLLQFN 142

Query: 134 PFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIG 193
            F +  G A L    +YPF+KRF   PQ  LG+ F+ G  +GW     S +WPA  L +G
Sbjct: 143 GFAVITGIASLVFVAIYPFAKRFTNWPQFFLGLAFSWGALMGWAGQFGSLAWPAVLLYVG 202

Query: 194 TIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTV 253
           +I W + +DT+YAHQDK+DD  +G+ STA LF   T  WL +LYG  ++   ++F    V
Sbjct: 203 SIAWTIGYDTIYAHQDKEDDTAVGIGSTALLFGENTHRWLVVLYGTALVMIFLSFWTAGV 262

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
           N  A+ GL  A  +  +++  LDI    QC   F S   VG+LI   LI+ L L
Sbjct: 263 NIIAYSGLAAAAIMLFRQVWVLDIDNVDQCLVLFKSNNRVGVLIFAGLILPLLL 316


>gi|325292033|ref|YP_004277897.1| 4-hydroxybenzoate octaprenyltransferase [Agrobacterium sp. H13-3]
 gi|325059886|gb|ADY63577.1| 4-hydroxybenzoate octaprenyltransferase [Agrobacterium sp. H13-3]
          Length = 317

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 132/288 (45%), Positives = 174/288 (60%), Gaps = 2/288 (0%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LARW    GW L + PC WS  LAA     +G   W T+ W+L ++ +G++  RGA
Sbjct: 30  PYAQLARWDRPIGWQLLMWPCFWSAALAANAAVASGGFSWGTLIWHLSLFFIGSVAMRGA 89

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT+NDL DH ID  V RTRSRPLPSG+ +R QA VF VLQ L   V+LLQFN F I  G
Sbjct: 90  GCTYNDLADHKIDMAVARTRSRPLPSGRVSRAQAKVFIVLQALAGLVVLLQFNGFAIATG 149

Query: 141 -FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVV 199
            F+L+F+++ YPF+KRF   PQ  LG+ F+ G  +GW     S +WPA  L +G+I W +
Sbjct: 150 IFSLVFVAI-YPFAKRFTNWPQFFLGLAFSWGALMGWAGQFGSIAWPAVLLYVGSIAWTI 208

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
            +DT+YAHQDK+DD  +G+ STA LF   T  WL  LYG  ++   ++F    VN  A+ 
Sbjct: 209 GYDTIYAHQDKEDDTAVGIGSTALLFGDNTHRWLVFLYGTALVMIALSFWGAGVNLIAYS 268

Query: 260 GLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
           GL  A  +  +++  LDI    QC   F S   VG+LI   LI+ L L
Sbjct: 269 GLAAAAIMLFRQVWVLDIDDVAQCLVLFKSNNRVGVLIFAGLILPLLL 316


>gi|241203335|ref|YP_002974431.1| 4-hydroxybenzoate polyprenyltransferase [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240857225|gb|ACS54892.1| 4-hydroxybenzoate polyprenyl transferase [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 322

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 130/285 (45%), Positives = 174/285 (61%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LARW    GW L + PC WS  LAA      G+   S +  +LF+Y +GA+  RGA
Sbjct: 33  PYAQLARWDRPIGWQLLMWPCFWSATLAANAAIGEGLYSGSLLVSHLFLYFIGAVAMRGA 92

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT+NDLVDH+ID +V RTRSRPLPSG+ TR +A +F  LQ L+   +LLQFN   + +G
Sbjct: 93  GCTYNDLVDHEIDMEVARTRSRPLPSGRVTRRRAKIFIGLQALVGLFVLLQFNWLNVFLG 152

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L I   YPF+KRF   PQ  LG+ F+ G  +GW  +    S+ A  L   ++ W + 
Sbjct: 153 VLSLGIVAFYPFAKRFTDWPQFYLGLAFSWGALMGWAGILGGLSFAAILLYAASVAWTIG 212

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQDK+DDELIGV STARLF  +T+ WL  LYG+ +    +AF L   N  A++G
Sbjct: 213 YDTIYAHQDKEDDELIGVRSTARLFGDRTRQWLIGLYGLTLALMFIAFVLAGANLIAFLG 272

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
           LL A  +   +I+ LDI  + QC + F S   VG++I   L +SL
Sbjct: 273 LLGAAGMFAWQIVRLDIDDADQCLALFKSNNRVGLIIFFGLFVSL 317


>gi|239831287|ref|ZP_04679616.1| 4-hydroxybenzoate polyprenyl transferase [Ochrobactrum intermedium
           LMG 3301]
 gi|239823554|gb|EEQ95122.1| 4-hydroxybenzoate polyprenyl transferase [Ochrobactrum intermedium
           LMG 3301]
          Length = 337

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 172/286 (60%), Gaps = 2/286 (0%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTI--FWYLFIYIVGAIVTR 78
           PY  LARW    GW L + PC WS  L A    + G   W+ +  FW+LF+++VGAI  R
Sbjct: 42  PYAQLARWDRPIGWQLLLWPCWWSAALVAGAGAKPGNGAWAVLPSFWHLFLFLVGAIAMR 101

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           G+ CT+NDLVD DID +V RTRSRPLPSGQ TR QA +F VLQ L+  V++LQFN F I 
Sbjct: 102 GSGCTYNDLVDQDIDDKVDRTRSRPLPSGQVTRGQAKLFLVLQALVGLVVVLQFNWFSIG 161

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +G   L I   YPF KR    PQ VLG+ F+ G  +GW A+  S S     L IG I W 
Sbjct: 162 LGIFSLLIVAAYPFMKRITDWPQFVLGLAFSWGALMGWAAVEGSLSLAPVLLYIGAILWT 221

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+YAHQDK+DD L+GV STARLF   TK  L +LYG  +  F  AF +  V   A 
Sbjct: 222 IGYDTIYAHQDKEDDALVGVRSTARLFGKHTKTALMVLYGGAIGFFAAAFAVAQVPMPAL 281

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            GLL A     ++II LDI    QC   F S  +VG LI + L++ 
Sbjct: 282 AGLLAASVHLYRQIIVLDIDNPDQCLKLFKSNNIVGWLIFLGLVLG 327


>gi|116250730|ref|YP_766568.1| 4-hydroxybenzoate polyprenyltransferase [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115255378|emb|CAK06453.1| putative para-hydroxybenzoate--polyprenyltransferase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 319

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 130/285 (45%), Positives = 174/285 (61%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LARW    GW L + PC WS  LAA      G+   S +  +LF+Y +GA+  RGA
Sbjct: 30  PYAQLARWDRPIGWQLLMWPCFWSATLAANAAIGEGLYSGSLLVSHLFLYFIGAVAMRGA 89

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT+NDLVDH ID +V RTRSRPLPSG+ TR  A +F  LQ L+  ++LLQFN   + +G
Sbjct: 90  GCTYNDLVDHKIDMEVARTRSRPLPSGRVTRAHAKIFIGLQALVGLLVLLQFNWLNVFLG 149

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L I   YPF+KRF   PQ  LG+ F+ G  +GW  +    S+ A  L   ++ W + 
Sbjct: 150 VLSLGIVAFYPFAKRFTDWPQFYLGLAFSWGALMGWAGILGGLSFAAILLYAASVAWTIG 209

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQDK+DDELIGV STARLF  +T+ WL  LYG+ ++   +AF L   N  A++ 
Sbjct: 210 YDTIYAHQDKEDDELIGVRSTARLFGDRTRQWLIGLYGLTLVLMFIAFALAGANLIAFLA 269

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
           LL A  +   +I+ LDI+ + QC + F S   VG++I   L ISL
Sbjct: 270 LLGAAGMFAWQIVRLDINDADQCLALFKSNNRVGLIIFFGLFISL 314


>gi|86356541|ref|YP_468433.1| prenyltransferase [Rhizobium etli CFN 42]
 gi|86280643|gb|ABC89706.1| 4-hydroxybenzoate octaprenyltransferase protein [Rhizobium etli CFN
           42]
          Length = 319

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 170/277 (61%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LARW    GW L + PC WS  LA+      G+   S +  +LF+Y +GA+  RGA
Sbjct: 30  PYAQLARWDRPIGWQLLMWPCFWSATLASNAAIGQGLYSGSLLVSHLFLYFIGAVAMRGA 89

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT+NDLVDH+ID +V RTRSRPLPSG+ TR +A +F  +Q L+   +LLQFN F +C+G
Sbjct: 90  GCTYNDLVDHEIDMEVARTRSRPLPSGRVTRARAKIFIGIQALVGLFVLLQFNWFTVCLG 149

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L I  LYP++KRF   PQ  LG+ F+ G  +GW  +    S+ A  L   ++ W + 
Sbjct: 150 LLSLGIVALYPYAKRFTDWPQFYLGLAFSWGALMGWAGILGGLSFAAILLYAASVAWTIG 209

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQDK+DDELIGV STARLF  +T+ WL  LYG+ ++    AF L   N  A+I 
Sbjct: 210 YDTIYAHQDKEDDELIGVRSTARLFGDKTRQWLVGLYGLTLVLMFAAFALAGANLIAFIA 269

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
           L  A  +   +I+ LDI+   QC + F S   VG+ I
Sbjct: 270 LFGAAGMFAWQIVRLDINDPAQCLALFKSNNRVGLTI 306


>gi|209548149|ref|YP_002280066.1| 4-hydroxybenzoate polyprenyltransferase [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209533905|gb|ACI53840.1| 4-hydroxybenzoate polyprenyl transferase [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 319

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 128/285 (44%), Positives = 174/285 (61%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LARW    GW L + PC WS  LAA      G+   S +  +L +Y +GA+  RGA
Sbjct: 30  PYAQLARWDRPIGWQLLMWPCFWSATLAANAAIGEGLYSGSLLVSHLVLYFIGAVAMRGA 89

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT+NDLVDH+ID +V RTRSRPLPSG+ TR  A +F  LQ L+   +LLQFN F + +G
Sbjct: 90  GCTYNDLVDHEIDMEVARTRSRPLPSGRVTRAHAKIFIGLQALVGLFVLLQFNWFTVFLG 149

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L I  LYP++KRF   PQ  LG+ F+ G  +GW  +    S+ A  L   ++ W + 
Sbjct: 150 VLSLGIVALYPYAKRFTDWPQFYLGLAFSWGALMGWAGILGGLSFAAVLLYAASVAWTIG 209

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQDK+DDELIGV STARLF  +T++WL  LYG+ ++    AF L   N  A++ 
Sbjct: 210 YDTIYAHQDKEDDELIGVRSTARLFGDRTRVWLIGLYGLTLVLMFAAFALAGANLIAFLA 269

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
           L  A  +   +I+ LDI+ + QC + F S   VG++I   L +SL
Sbjct: 270 LFGAAGMFAWQIVRLDINDAAQCLALFKSNNRVGLIIFFGLFVSL 314


>gi|163761034|ref|ZP_02168112.1| 4-hydroxybenzoate octaprenyltransferase [Hoeflea phototrophica
           DFL-43]
 gi|162281815|gb|EDQ32108.1| 4-hydroxybenzoate octaprenyltransferase [Hoeflea phototrophica
           DFL-43]
          Length = 332

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 125/286 (43%), Positives = 175/286 (61%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           P+  LARW    GW L + PC WS  LAA    ++G    S   W+L +++ GAI  RGA
Sbjct: 46  PHAQLARWDRPIGWQLLMWPCFWSAALAANVASQSGTWSPSVTIWHLALFMAGAIAMRGA 105

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWNDLVD+ ID++V RTRSRPLPSG+ ++  A+ F V Q L+ F++L+QFN F I +G
Sbjct: 106 GCTWNDLVDYKIDAKVARTRSRPLPSGRISKRAAVAFLVAQALVGFLVLIQFNVFSIILG 165

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L +  +YPF+KRF   PQ  LG+ F+ G  +GW  L A  S     L  G I W + 
Sbjct: 166 IASLGVVAVYPFAKRFTDWPQFFLGLAFSWGALMGWAGLFAELSLAPLLLYAGAIAWTIG 225

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQDK+DD L+GV STARLF   TK WL + YG+F    ++A+ L  V + A+ G
Sbjct: 226 YDTIYAHQDKEDDALVGVRSTARLFGANTKAWLVLFYGLFAALTLMAYWLSGVAWPAYAG 285

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
           L + + L   +I  ++I  + QC S F +   VG+++ + L  +L 
Sbjct: 286 LALGVILLGWQIRVINIDDADQCLSLFKANSRVGLIVFLGLGAALL 331


>gi|319405360|emb|CBI78977.1| 4-hydroxybenzoate octaprenyltransferase [Bartonella sp. AR 15-3]
          Length = 335

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 137/295 (46%), Positives = 177/295 (60%), Gaps = 12/295 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLA--AYPLRRAGVL----GWSTIFWYLFIYIVGAI 75
           Y  LARW    GW L + PC WST +A  +Y + +  +L     W    WYLF++ VG+I
Sbjct: 39  YAQLARWDRPIGWKLLMWPCFWSTTMAIFSYEISQLSILSIVINW---IWYLFLFFVGSI 95

Query: 76  VTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPF 135
             RGA CTWNDLVD +IDSQ+ RTRSRPLP+GQ +RFQA +F ++Q +I   +LLQFN F
Sbjct: 96  AMRGAGCTWNDLVDQEIDSQIERTRSRPLPTGQVSRFQAKIFILIQCIIGLGVLLQFNVF 155

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTI 195
              +G + L     YPF KR    PQ  LG+ F  G  +GW A+H S SW    L IG+I
Sbjct: 156 TFFLGLSSLVAVAFYPFMKRITNWPQFFLGVAFNWGALMGWAAVHGSLSWAPIALYIGSI 215

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT+YAHQDK DD ++GV STA LF  +TK  L +LYG FV+   +AF L  V  
Sbjct: 216 LWTIGYDTIYAHQDKDDDVIVGVGSTALLFGKKTKYALVLLYGGFVILTSLAFYLAHVPI 275

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI---LICLIISLFL 307
            +++G+LIA      +I  +DI  S QC   F S   VG LI   L+C  IS  L
Sbjct: 276 LSFLGILIAAIHMFIQIKVIDIDNSLQCLQLFKSNSFVGFLIFAGLVCGGISTIL 330


>gi|153007875|ref|YP_001369090.1| 4-hydroxybenzoate polyprenyltransferase [Ochrobactrum anthropi ATCC
           49188]
 gi|151559763|gb|ABS13261.1| 4-hydroxybenzoate polyprenyl transferase [Ochrobactrum anthropi
           ATCC 49188]
          Length = 342

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 136/286 (47%), Positives = 170/286 (59%), Gaps = 2/286 (0%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTI--FWYLFIYIVGAIVTR 78
           PY  LARW    GW L + PC WS  L A    + G   W+ +   W+L ++++GAI  R
Sbjct: 47  PYAQLARWDRPIGWQLLLWPCWWSAALVAGAGAKPGDGAWAVMPSIWHLVLFLIGAIAMR 106

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           G+ CT+NDLVD DID +V RTRSRPLPSGQ TR QA +F VLQ L+  V++LQFN F I 
Sbjct: 107 GSGCTYNDLVDQDIDDKVDRTRSRPLPSGQVTRGQAKIFLVLQALVGLVVVLQFNWFTIG 166

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +G   L I   YPF KR    PQ VLG+ F+ G  +GW A+  S S     L IG I W 
Sbjct: 167 LGIFSLLIVAAYPFMKRITNWPQFVLGLAFSWGALMGWAAVEGSLSLAPVLLYIGAILWT 226

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+YAHQDK+DD L+GV STARLF   TK  L ILYG  +  F  AF +  V   A 
Sbjct: 227 IGYDTIYAHQDKEDDALVGVRSTARLFGKHTKTALMILYGGAIGFFAAAFAVAQVPMPAL 286

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            GLL A     ++II LDI    QC   F S  +VG LI + L++ 
Sbjct: 287 AGLLAAGVHLYRQIIVLDIDNPDQCLKLFKSNNIVGWLIFLGLVLG 332


>gi|319406933|emb|CBI80570.1| 4-hydroxybenzoate octaprenyltransferase [Bartonella sp. 1-1C]
          Length = 335

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 129/284 (45%), Positives = 172/284 (60%), Gaps = 3/284 (1%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTI---FWYLFIYIVGAIVTR 78
           Y  LARW    GW L + PC WST +A +    + +   S++    WYLF++ VG+I  R
Sbjct: 39  YAQLARWDRPIGWKLLMWPCFWSTTMAIFSCEMSQLSILSSVVNWIWYLFLFFVGSIAMR 98

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CTWNDLVD +IDS++ RTRSRPLP+GQ +RFQA +F ++Q +I   +LLQFN F   
Sbjct: 99  GAGCTWNDLVDQEIDSKIERTRSRPLPTGQVSRFQAKIFILIQCIIGLGVLLQFNEFTFF 158

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +G + L   +LYPF KR    PQ  LGI F  G  +GW A+H S SW    L  G+I W 
Sbjct: 159 LGLSSLVAVILYPFMKRITNWPQFFLGIAFNWGALMGWAAVHGSLSWAPIALYGGSILWT 218

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+YAHQDK DD ++GV STA LF  +TK  L  LYG FV+   +AF L  V   ++
Sbjct: 219 IGYDTIYAHQDKDDDVIVGVRSTALLFGKKTKYALIFLYGGFVILTSLAFYLAQVPILSF 278

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           +G+ IA      +I  +DI  + QC   F S   VG LI + L+
Sbjct: 279 LGIFIAAIHMFIQIKVIDIDNNLQCLQLFKSNSFVGFLIFVGLV 322


>gi|227821058|ref|YP_002825028.1| 4-hydroxybenzoate polyprenyltransferase [Sinorhizobium fredii
           NGR234]
 gi|227340057|gb|ACP24275.1| putative 4-hydroxybenzoate octaprenyltransferase [Sinorhizobium
           fredii NGR234]
          Length = 319

 Score =  245 bits (625), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 127/292 (43%), Positives = 180/292 (61%)

Query: 14  IMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVG 73
           ++  A+ PY  LARW    GW L + PCLWS  LA       G    +   +++ +++ G
Sbjct: 23  VLPRALWPYAQLARWDRPIGWQLLMWPCLWSAALAGGAAAALGSFSPARFLFHVILFVAG 82

Query: 74  AIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFN 133
           AI  RGA CT+ND+VDH+ID +V RTRSRPLPSG+ TR QA VF VLQ L+  V+LLQFN
Sbjct: 83  AIAMRGAGCTYNDIVDHEIDMEVARTRSRPLPSGRVTRAQAKVFMVLQALVGLVVLLQFN 142

Query: 134 PFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIG 193
            F + +G A L +  +YPF+KRF   PQ  LG+ F+ G  +GW A   S S+ A  L   
Sbjct: 143 AFTVFLGIASLGLVAIYPFAKRFTDWPQFFLGLAFSWGAIMGWSAEFGSLSFAAVLLYAA 202

Query: 194 TIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTV 253
            I W + +DT+YA+QD++DD LIGV STAR F    + WL  LYG+ +L   +AF     
Sbjct: 203 AIAWTIGYDTIYAYQDREDDALIGVRSTARRFGDNPRPWLIGLYGLTILLMFLAFLAAGT 262

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
            FFA +GL++A  +   +I+ L+I   +QC + F   GVVG+++   ++++L
Sbjct: 263 GFFAHVGLVVAAVMLAYQILVLNIHDPEQCLALFKFNGVVGLIVFAGMVLAL 314


>gi|218672078|ref|ZP_03521747.1| prenyltransferase [Rhizobium etli GR56]
          Length = 298

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 164/269 (60%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LARW    GW L + PC WS  LAA      GV   S +  +LF+Y +GA+  RGA
Sbjct: 30  PYAQLARWDRPIGWQLLMWPCFWSATLAANAAIDEGVYSGSLLVSHLFLYFIGAVAMRGA 89

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT+NDLVDH+ID QV RTRSRPLPSG+ TR  A +F  LQ L+   +LLQFN F + +G
Sbjct: 90  GCTYNDLVDHEIDMQVARTRSRPLPSGRVTRAHAKIFIGLQALVGLFVLLQFNWFTVFLG 149

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L I  LYP++KRF   PQ  LG+ F+ G  +GW  +    S  +  L   ++ W + 
Sbjct: 150 LLSLGIVALYPYAKRFTDWPQFYLGLAFSWGALMGWAGILGEISVASVLLYAASVAWTIG 209

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQDK+DDELIGV STARLF  +T+ WL  LYG+ ++    AF L   N  A++ 
Sbjct: 210 YDTIYAHQDKEDDELIGVRSTARLFGDRTRAWLIGLYGLTLVLMFAAFALAGANLIAFLA 269

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHS 289
           LL A  +   +I+ LDI  + QC + F S
Sbjct: 270 LLGAAGMFAWQIVRLDIEDAAQCLALFKS 298


>gi|319403921|emb|CBI77509.1| 4-hydroxybenzoate octaprenyltransferase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 334

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 130/286 (45%), Positives = 173/286 (60%), Gaps = 8/286 (2%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLA-AYPLRR----AGVLGWSTIFWYLFIYIVGAIV 76
           Y  LARW    GW L + PC WST +A +  + +    + V+ W    WYLF++ VG+I 
Sbjct: 39  YAQLARWDRPIGWKLLMWPCFWSTTMAISCEMSQLSILSSVVNW---IWYLFLFFVGSIA 95

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CTWNDLVD +IDS++ RTRSRPLP+GQ +RFQA +F ++Q +I   +LLQFN F 
Sbjct: 96  MRGAGCTWNDLVDQEIDSKIERTRSRPLPTGQVSRFQAKIFILIQCIIGLGVLLQFNKFT 155

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
             +G + L   +LYPF KR    PQ  LGI F  G  +GW A+H S SW    L  G+I 
Sbjct: 156 FFLGLSSLVAVILYPFMKRITNWPQFFLGIAFNWGALMGWAAVHGSLSWAPIALYGGSIL 215

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
           W + +DT+YAHQDK DD ++GV STA LF  +TK  L  LYG FV+   +AF L  V   
Sbjct: 216 WTIGYDTIYAHQDKDDDVIVGVRSTALLFGKKTKYALIFLYGGFVILTSLAFYLAQVPIL 275

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           +++G+ IA      +I  +DI  + QC   F S   VG LI + L+
Sbjct: 276 SFLGIFIAAIHMFIQIKVIDIDNNLQCLRLFKSNSFVGFLIFVGLV 321


>gi|319408209|emb|CBI81862.1| 4-hydroxybenzoate octaprenyltransferase [Bartonella schoenbuchensis
           R1]
          Length = 334

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 129/284 (45%), Positives = 167/284 (58%), Gaps = 3/284 (1%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIF---WYLFIYIVGAIVTR 78
           Y  LARW    GW L + PC WST +A        V   S I    WYLF++ +G+I  R
Sbjct: 39  YAQLARWDRPIGWKLLMWPCFWSTTMAMLSYEMPQVPLLSIIMCWIWYLFLFFLGSIAMR 98

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CTWNDLVDH IDSQV RTRSRPLP+GQ +RFQA +F ++Q  I   +LLQFN F   
Sbjct: 99  GAGCTWNDLVDHKIDSQVERTRSRPLPAGQVSRFQAKIFILVQCFIGLGVLLQFNAFSFF 158

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +G + L    +YPF KR    PQ  LG+ F  G  +GW  ++ S SW    L  G+I W 
Sbjct: 159 LGISSLVAVAIYPFMKRITNWPQFFLGVAFNWGALMGWAVVYGSLSWAPIALYAGSILWT 218

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+YAHQDK+DD ++GV+STARLF   TK  L ILY  F++   +AF L  V+  ++
Sbjct: 219 IGYDTIYAHQDKQDDAIVGVHSTARLFGKSTKCALVILYSGFIILVSLAFYLAQVSILSF 278

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           +G+ IA      +I  +DI  S QC   F S   VG  I   L+
Sbjct: 279 VGVFIAAIHMFIQIKVIDIDDSSQCLKLFRSNSFVGFFIFAGLV 322


>gi|319898595|ref|YP_004158688.1| 4-hydroxybenzoate octaprenyltransferase [Bartonella clarridgeiae
           73]
 gi|319402559|emb|CBI76104.1| 4-hydroxybenzoate octaprenyltransferase [Bartonella clarridgeiae
           73]
          Length = 335

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 139/306 (45%), Positives = 181/306 (59%), Gaps = 7/306 (2%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIF--- 64
           +WV D ++  ++  Y  LARW    GW L + PC WST +A +    + +   S I    
Sbjct: 26  QWVYD-LLPCSLWLYAQLARWDRPIGWKLLMWPCFWSTTMAIFSCEMSQLSLLSIIINWV 84

Query: 65  WYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLI 124
           WYLF++ +G+I  RGA CTWNDLVD +IDSQ+ RTRSRPLP+GQ +RFQA VF ++Q +I
Sbjct: 85  WYLFLFFLGSIAMRGAGCTWNDLVDQEIDSQIERTRSRPLPTGQVSRFQAKVFILIQCVI 144

Query: 125 SFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFS 184
              +LLQFN F   +G + L    LYPF KR    PQ  LGI F  G  +GW A+H S S
Sbjct: 145 GLGVLLQFNVFTFFLGLSSLVAVALYPFMKRITNWPQFFLGIAFNWGALMGWAAVHGSLS 204

Query: 185 WPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCF 244
                L IG+I W + +DT+YAHQDK DD ++GV STA LF  +TK  L ILY  FV+  
Sbjct: 205 SAPIVLYIGSILWTIGYDTIYAHQDKDDDVIVGVRSTALLFGKRTKYALAILYSGFVILT 264

Query: 245 MVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI---LICL 301
            +AF L  V   +++G+ IA      +I  +DI    QC   F S   VG LI   LIC 
Sbjct: 265 SLAFYLAQVPILSFLGIFIAAVHMFIQIKVIDIDNGLQCLQLFKSNSFVGFLIFAGLICG 324

Query: 302 IISLFL 307
            IS+ L
Sbjct: 325 GISMIL 330


>gi|121602063|ref|YP_988712.1| prenyltransferase [Bartonella bacilliformis KC583]
 gi|120614240|gb|ABM44841.1| 4-hydroxybenzoate polyprenyl transferase [Bartonella bacilliformis
           KC583]
          Length = 334

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/287 (44%), Positives = 169/287 (58%), Gaps = 9/287 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLA--AYPLRRAGVLG----WSTIFWYLFIYIVGAI 75
           Y  LARW    GW L + PC WST +A  +Y + +  +L     W    WYLF++ +G+I
Sbjct: 39  YAQLARWDRPIGWKLLMWPCFWSTTMALLSYEISQQPLLSVMIHW---IWYLFLFFLGSI 95

Query: 76  VTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPF 135
             RGA CTWNDLVDH+IDSQ+ RTRSRPLP+GQ +RFQA VF ++Q  +   +LLQFN F
Sbjct: 96  AMRGAGCTWNDLVDHEIDSQIERTRSRPLPAGQISRFQAKVFILVQCFVGLGVLLQFNMF 155

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTI 195
              +G + L     YPF KR    PQ  LGI F  G  +GW  ++   SW    L  G+I
Sbjct: 156 SFYLGISSLVAVAFYPFMKRITDWPQFFLGIAFNWGALMGWAVVYGRLSWAPIALYAGSI 215

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT+YAHQD+KDD ++GV STARLF   TK  L +LY  F++   +AF L  V  
Sbjct: 216 LWTIGYDTIYAHQDRKDDAIVGVRSTARLFEKSTKRALILLYSGFLILVSLAFYLAKVPI 275

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
            +++GL  A      +I A+DI  S+QC   F S   VG  I   LI
Sbjct: 276 ISFLGLFCAGVHMFIQIKAIDIDNSEQCLKLFKSNSFVGFFIFAGLI 322


>gi|17987801|ref|NP_540435.1| 4-hydroxybenzoate polyprenyltransferase [Brucella melitensis bv. 1
           str. 16M]
 gi|256044134|ref|ZP_05447041.1| 4-hydroxybenzoate polyprenyltransferase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|260563491|ref|ZP_05833977.1| UbiA prenyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|265990545|ref|ZP_06103102.1| prenyltransferase [Brucella melitensis bv. 1 str. Rev.1]
 gi|17983526|gb|AAL52699.1| 4-hydroxybenzoate octaprenyltransferase [Brucella melitensis bv. 1
           str. 16M]
 gi|260153507|gb|EEW88599.1| UbiA prenyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|263001329|gb|EEZ13904.1| prenyltransferase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 333

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 139/284 (48%), Positives = 173/284 (60%), Gaps = 2/284 (0%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTI--FWYLFIYIVGAIVTR 78
           PY  LARW    GW L + PC WST L A    +AG   WS +  FW+LF+++VGAI  R
Sbjct: 38  PYAQLARWDRPIGWQLLLWPCWWSTALVAGAGAKAGDGAWSVLPSFWHLFLFLVGAIAMR 97

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT+NDLVD +ID +V RTRSRPLPSGQ TR QA +F VLQ L+   ++LQFN F + 
Sbjct: 98  GAGCTYNDLVDQEIDDKVDRTRSRPLPSGQVTRKQAKLFVVLQALVGLAVVLQFNWFSVG 157

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +G   L I   YPF KR    PQ VLG+ F+ G  +GW A   S S P   L IG I W 
Sbjct: 158 LGIFSLLIVAAYPFMKRITDWPQFVLGLAFSWGALMGWAATEGSLSLPPVLLYIGAILWT 217

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+YAHQDK+DD L+GV STARLF   TK  L +LYG  +  F  AF ++ V   A 
Sbjct: 218 IGYDTIYAHQDKEDDALVGVRSTARLFGKHTKTALMVLYGGAIGFFAAAFAVVQVPMPAL 277

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
            GLL A     ++I+ LDI    QC   F S  +VG LI + L+
Sbjct: 278 AGLLAAGAHLYRQILVLDIDNPDQCLRLFKSNNIVGWLIFLGLV 321


>gi|23501318|ref|NP_697445.1| 4-hydroxybenzoate polyprenyltransferase [Brucella suis 1330]
 gi|23347208|gb|AAN29360.1| 4-hydroxybenzoate octaprenyltransferase [Brucella suis 1330]
          Length = 333

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 139/284 (48%), Positives = 172/284 (60%), Gaps = 2/284 (0%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTI--FWYLFIYIVGAIVTR 78
           PY  LARW    GW L + PC WST L A    +AG   WS +  FW+LF+++VGAI  R
Sbjct: 38  PYAQLARWDRPIGWQLLLWPCWWSTALVAGAGAKAGDGAWSVLPSFWHLFLFLVGAIAMR 97

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT+NDLVD +ID +V RTRSRPLPSGQ TR QA +F VLQ L+   ++LQFN F + 
Sbjct: 98  GAGCTYNDLVDQEIDDKVDRTRSRPLPSGQVTRKQAKLFVVLQALVGLAVVLQFNWFSVA 157

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +G   L I   YPF KR    PQ VLG+ F+ G  +GW A   S S P   L IG I W 
Sbjct: 158 LGIFSLLIVAAYPFMKRITDWPQFVLGLAFSWGALMGWAATEGSLSLPPVLLYIGAILWT 217

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+YAHQDK+DD L+GV STARLF   TK  L +LYG  +  F  AF +  V   A 
Sbjct: 218 IGYDTIYAHQDKEDDALVGVRSTARLFGKHTKTALMVLYGGAIGFFAAAFAVAQVPMPAL 277

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
            GLL A     ++I+ LDI    QC   F S  +VG LI + L+
Sbjct: 278 AGLLAAGAHLYRQILVLDIDNPDQCLRLFKSNNIVGWLIFLGLV 321


>gi|306845023|ref|ZP_07477604.1| 4-hydroxybenzoate polyprenyl transferase [Brucella sp. BO1]
 gi|306274655|gb|EFM56444.1| 4-hydroxybenzoate polyprenyl transferase [Brucella sp. BO1]
          Length = 333

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 139/284 (48%), Positives = 172/284 (60%), Gaps = 2/284 (0%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTI--FWYLFIYIVGAIVTR 78
           PY  LARW    GW L + PC WST L A    +AG   WS +  FW+LF+++VGAI  R
Sbjct: 38  PYAQLARWDRPIGWQLLLWPCWWSTALVAGAGAKAGDGAWSVLPSFWHLFLFLVGAIAMR 97

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT+NDLVD +ID +V RTRSRPLPSGQ TR QA +F VLQ L+   ++LQFN F + 
Sbjct: 98  GAGCTYNDLVDQEIDDKVDRTRSRPLPSGQVTRKQAKLFVVLQALVGLAVVLQFNWFSVG 157

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +G   L I   YPF KR    PQ VLG+ F+ G  +GW A   S S P   L IG I W 
Sbjct: 158 LGIFSLLIVAAYPFMKRITDWPQFVLGLAFSWGALMGWAATEGSLSLPPVLLYIGAILWT 217

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+YAHQDK+DD L+GV STARLF   TK  L +LYG  +  F  AF +  V   A 
Sbjct: 218 IGYDTIYAHQDKEDDALVGVRSTARLFGKHTKTALMVLYGGAIGFFAAAFAVAQVPMPAL 277

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
            GLL A     ++I+ LDI    QC   F S  +VG LI + L+
Sbjct: 278 AGLLAAGAHLYRQILVLDIDNPDQCLRLFKSNNIVGWLIFLGLV 321


>gi|222147727|ref|YP_002548684.1| 4-hydroxybenzoate polyprenyltransferase [Agrobacterium vitis S4]
 gi|221734715|gb|ACM35678.1| 4-hydroxybenzoate polyprenyl transferase [Agrobacterium vitis S4]
          Length = 317

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 137/293 (46%), Positives = 181/293 (61%), Gaps = 2/293 (0%)

Query: 14  IMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPL-RRAGVLGWSTIFWYLFIYIV 72
           ++  A+ PY  LARW    GW L + PC WS+ LAA  L  R  +L W+ I  +L ++ V
Sbjct: 23  LLPRAVWPYAQLARWDRPIGWELLMWPCFWSSALAANFLASRDALLVWTFIA-HLLLFFV 81

Query: 73  GAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQF 132
           GA+V RGA CT+NDLVD  ID +V RTRSRPLPSG+ TR QA +F V Q ++   +L  F
Sbjct: 82  GAVVMRGAGCTYNDLVDETIDMEVARTRSRPLPSGRVTRGQAKLFIVAQLVVGAAVLFCF 141

Query: 133 NPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI 192
           N F I +G A L I ++YPF+KRF   PQ  LG+ F+ G  +GW  L  S S  A  L I
Sbjct: 142 NGFSILLGLASLAIVVIYPFAKRFTDWPQFFLGLAFSWGGLMGWAGLTGSMSIAAVLLYI 201

Query: 193 GTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLT 252
             + W + +DT+YAHQDK+DD LIGV STARLF+  TK+WL   YG   L   ++F L  
Sbjct: 202 AAVVWTIGYDTIYAHQDKEDDALIGVRSTARLFAEDTKIWLTGFYGAMGLLLALSFVLAG 261

Query: 253 VNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
             F A++GLL+AL L   +I  LDI    QC + F   G VG+++ I L+ S+
Sbjct: 262 AGFPAYLGLLVALVLLGYQIKVLDIHNPVQCLALFKLNGKVGLILFIGLVASI 314


>gi|254713018|ref|ZP_05174829.1| 4-hydroxybenzoate polyprenyltransferase [Brucella ceti M644/93/1]
 gi|254716627|ref|ZP_05178438.1| 4-hydroxybenzoate polyprenyltransferase [Brucella ceti M13/05/1]
 gi|261218428|ref|ZP_05932709.1| prenyltransferase [Brucella ceti M13/05/1]
 gi|261320723|ref|ZP_05959920.1| prenyltransferase [Brucella ceti M644/93/1]
 gi|260923517|gb|EEX90085.1| prenyltransferase [Brucella ceti M13/05/1]
 gi|261293413|gb|EEX96909.1| prenyltransferase [Brucella ceti M644/93/1]
          Length = 333

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 139/288 (48%), Positives = 173/288 (60%), Gaps = 2/288 (0%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTI--FWYLFIYIVGAIVTR 78
           PY  LARW    GW L + PC WST L A    +AG   WS +  FW+LF+++VGAI  R
Sbjct: 38  PYAQLARWDRPIGWQLLLWPCWWSTALVAGAGAKAGDGAWSVLPSFWHLFLFLVGAIAMR 97

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT+NDLVD +ID +V RTRSRPLPSGQ TR QA +F VLQ L+   ++LQFN F + 
Sbjct: 98  GAGCTYNDLVDQEIDDKVDRTRSRPLPSGQVTRKQAKLFVVLQALVGLAVVLQFNWFSVG 157

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +G   L I   YPF KR    PQ VLG+ F+ G  +GW A   S S P   L IG I W 
Sbjct: 158 LGIFSLLIVAAYPFMKRITDWPQFVLGLAFSWGALMGWAATEGSLSLPPVLLYIGAILWT 217

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+YAHQDK+DD L+GV STARLF   TK  L +LYG  +  F  AF +  V   A 
Sbjct: 218 IGYDTIYAHQDKEDDALVGVRSTARLFGKHTKTALMVLYGGAIGFFAAAFAVAQVPMPAL 277

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
            GLL A     ++I+ LDI    QC   F S  +VG LI + L+  + 
Sbjct: 278 AGLLAAGAHLYRQILVLDIDNPDQCLRLFKSNNIVGWLIFLGLVFGIL 325


>gi|161618390|ref|YP_001592277.1| prenyltransferase [Brucella canis ATCC 23365]
 gi|254703768|ref|ZP_05165596.1| 4-hydroxybenzoate polyprenyltransferase [Brucella suis bv. 3 str.
           686]
 gi|260566978|ref|ZP_05837448.1| UbiA prenyltransferase [Brucella suis bv. 4 str. 40]
 gi|261754415|ref|ZP_05998124.1| prenyltransferase [Brucella suis bv. 3 str. 686]
 gi|161335201|gb|ABX61506.1| 4-hydroxybenzoate polyprenyl transferase [Brucella canis ATCC
           23365]
 gi|260156496|gb|EEW91576.1| UbiA prenyltransferase [Brucella suis bv. 4 str. 40]
 gi|261744168|gb|EEY32094.1| prenyltransferase [Brucella suis bv. 3 str. 686]
          Length = 333

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 138/284 (48%), Positives = 172/284 (60%), Gaps = 2/284 (0%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTI--FWYLFIYIVGAIVTR 78
           PY  LARW    GW L + PC WST L A    +AG   WS +  FW+LF+++VGAI  R
Sbjct: 38  PYAQLARWDRPIGWQLLLWPCWWSTALVAGAGAKAGDGAWSVLPSFWHLFLFLVGAIAMR 97

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT+NDLVD +ID +V RTRSRPLPSGQ TR QA +F +LQ L+   ++LQFN F + 
Sbjct: 98  GAGCTYNDLVDQEIDDKVDRTRSRPLPSGQVTRKQAKLFVILQALVGLAVVLQFNWFSVA 157

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +G   L I   YPF KR    PQ VLG+ F+ G  +GW A   S S P   L IG I W 
Sbjct: 158 LGIFSLLIVAAYPFMKRITDWPQFVLGLAFSWGALMGWAATEGSLSLPPVLLYIGAILWT 217

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+YAHQDK+DD L+GV STARLF   TK  L +LYG  +  F  AF +  V   A 
Sbjct: 218 IGYDTIYAHQDKEDDALVGVRSTARLFGKHTKTALMVLYGGAIGFFAAAFAVAQVPMPAL 277

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
            GLL A     ++I+ LDI    QC   F S  +VG LI + L+
Sbjct: 278 AGLLAAGAHLYRQILVLDIDNPDQCLRLFKSNNIVGWLIFLGLV 321


>gi|62289402|ref|YP_221195.1| 4-hydroxybenzoate polyprenyltransferase [Brucella abortus bv. 1
           str. 9-941]
 gi|82699329|ref|YP_413903.1| 4-hydroxybenzoate polyprenyltransferase [Brucella melitensis biovar
           Abortus 2308]
 gi|163842697|ref|YP_001627101.1| prenyltransferase [Brucella suis ATCC 23445]
 gi|189023653|ref|YP_001934421.1| UbiA prenyltransferase [Brucella abortus S19]
 gi|225626922|ref|ZP_03784961.1| 4-hydroxybenzoate polyprenyl transferase [Brucella ceti str. Cudo]
 gi|225851951|ref|YP_002732184.1| 4-hydroxybenzoate polyprenyltransferase [Brucella melitensis ATCC
           23457]
 gi|237814888|ref|ZP_04593886.1| 4-hydroxybenzoate polyprenyl transferase [Brucella abortus str.
           2308 A]
 gi|254688715|ref|ZP_05151969.1| 4-hydroxybenzoate polyprenyltransferase [Brucella abortus bv. 6
           str. 870]
 gi|254693198|ref|ZP_05155026.1| 4-hydroxybenzoate polyprenyltransferase [Brucella abortus bv. 3
           str. Tulya]
 gi|254696843|ref|ZP_05158671.1| 4-hydroxybenzoate polyprenyltransferase [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254701222|ref|ZP_05163050.1| 4-hydroxybenzoate polyprenyltransferase [Brucella suis bv. 5 str.
           513]
 gi|254707853|ref|ZP_05169681.1| 4-hydroxybenzoate polyprenyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|254709565|ref|ZP_05171376.1| 4-hydroxybenzoate polyprenyltransferase [Brucella pinnipedialis
           B2/94]
 gi|254729748|ref|ZP_05188326.1| 4-hydroxybenzoate polyprenyltransferase [Brucella abortus bv. 4
           str. 292]
 gi|256031057|ref|ZP_05444671.1| 4-hydroxybenzoate polyprenyltransferase [Brucella pinnipedialis
           M292/94/1]
 gi|256060551|ref|ZP_05450719.1| 4-hydroxybenzoate polyprenyltransferase [Brucella neotomae 5K33]
 gi|256112937|ref|ZP_05453845.1| 4-hydroxybenzoate polyprenyltransferase [Brucella melitensis bv. 3
           str. Ether]
 gi|256159121|ref|ZP_05456942.1| 4-hydroxybenzoate polyprenyltransferase [Brucella ceti M490/95/1]
 gi|256254460|ref|ZP_05459996.1| 4-hydroxybenzoate polyprenyltransferase [Brucella ceti B1/94]
 gi|256256962|ref|ZP_05462498.1| 4-hydroxybenzoate polyprenyltransferase [Brucella abortus bv. 9
           str. C68]
 gi|256264539|ref|ZP_05467071.1| UbiA prenyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|256368871|ref|YP_003106377.1| 4-hydroxybenzoate octaprenyltransferase [Brucella microti CCM 4915]
 gi|260168188|ref|ZP_05754999.1| 4-hydroxybenzoate polyprenyltransferase [Brucella sp. F5/99]
 gi|260545846|ref|ZP_05821587.1| UbiA prenyltransferase [Brucella abortus NCTC 8038]
 gi|260754193|ref|ZP_05866541.1| prenyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260757413|ref|ZP_05869761.1| prenyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260761238|ref|ZP_05873581.1| prenyltransferase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883218|ref|ZP_05894832.1| prenyltransferase [Brucella abortus bv. 9 str. C68]
 gi|261213440|ref|ZP_05927721.1| prenyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|261221632|ref|ZP_05935913.1| prenyltransferase [Brucella ceti B1/94]
 gi|261315342|ref|ZP_05954539.1| prenyltransferase [Brucella pinnipedialis M163/99/10]
 gi|261317093|ref|ZP_05956290.1| prenyltransferase [Brucella pinnipedialis B2/94]
 gi|261324546|ref|ZP_05963743.1| prenyltransferase [Brucella neotomae 5K33]
 gi|261751761|ref|ZP_05995470.1| prenyltransferase [Brucella suis bv. 5 str. 513]
 gi|261757648|ref|ZP_06001357.1| UbiA prenyltransferase [Brucella sp. F5/99]
 gi|265988129|ref|ZP_06100686.1| prenyltransferase [Brucella pinnipedialis M292/94/1]
 gi|265994375|ref|ZP_06106932.1| prenyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|265997594|ref|ZP_06110151.1| prenyltransferase [Brucella ceti M490/95/1]
 gi|294851795|ref|ZP_06792468.1| 4-hydroxybenzoate polyprenyl transferase [Brucella sp. NVSL
           07-0026]
 gi|297247815|ref|ZP_06931533.1| 4-hydroxybenzoate polyprenyl transferase [Brucella abortus bv. 5
           str. B3196]
 gi|306842319|ref|ZP_07474979.1| 4-hydroxybenzoate polyprenyl transferase [Brucella sp. BO2]
 gi|62195534|gb|AAX73834.1| UbiA, 4-hydroxybenzoate octaprenyltransferase [Brucella abortus bv.
           1 str. 9-941]
 gi|82615430|emb|CAJ10399.1| UbiA prenyltransferase:4-hydroxybenzoate polyprenyl transferase,
           proteobacterial [Brucella melitensis biovar Abortus
           2308]
 gi|163673420|gb|ABY37531.1| 4-hydroxybenzoate polyprenyl transferase [Brucella suis ATCC 23445]
 gi|189019225|gb|ACD71947.1| UbiA prenyltransferase [Brucella abortus S19]
 gi|225618579|gb|EEH15622.1| 4-hydroxybenzoate polyprenyl transferase [Brucella ceti str. Cudo]
 gi|225640316|gb|ACO00230.1| 4-hydroxybenzoate polyprenyl transferase [Brucella melitensis ATCC
           23457]
 gi|237789725|gb|EEP63935.1| 4-hydroxybenzoate polyprenyl transferase [Brucella abortus str.
           2308 A]
 gi|255999029|gb|ACU47428.1| 4-hydroxybenzoate octaprenyltransferase [Brucella microti CCM 4915]
 gi|260097253|gb|EEW81128.1| UbiA prenyltransferase [Brucella abortus NCTC 8038]
 gi|260667731|gb|EEX54671.1| prenyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260671670|gb|EEX58491.1| prenyltransferase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674301|gb|EEX61122.1| prenyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260872746|gb|EEX79815.1| prenyltransferase [Brucella abortus bv. 9 str. C68]
 gi|260915047|gb|EEX81908.1| prenyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|260920216|gb|EEX86869.1| prenyltransferase [Brucella ceti B1/94]
 gi|261296316|gb|EEX99812.1| prenyltransferase [Brucella pinnipedialis B2/94]
 gi|261300526|gb|EEY04023.1| prenyltransferase [Brucella neotomae 5K33]
 gi|261304368|gb|EEY07865.1| prenyltransferase [Brucella pinnipedialis M163/99/10]
 gi|261737632|gb|EEY25628.1| UbiA prenyltransferase [Brucella sp. F5/99]
 gi|261741514|gb|EEY29440.1| prenyltransferase [Brucella suis bv. 5 str. 513]
 gi|262552062|gb|EEZ08052.1| prenyltransferase [Brucella ceti M490/95/1]
 gi|262765488|gb|EEZ11277.1| prenyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|263094872|gb|EEZ18610.1| UbiA prenyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|264660326|gb|EEZ30587.1| prenyltransferase [Brucella pinnipedialis M292/94/1]
 gi|294820384|gb|EFG37383.1| 4-hydroxybenzoate polyprenyl transferase [Brucella sp. NVSL
           07-0026]
 gi|297174984|gb|EFH34331.1| 4-hydroxybenzoate polyprenyl transferase [Brucella abortus bv. 5
           str. B3196]
 gi|306287576|gb|EFM59032.1| 4-hydroxybenzoate polyprenyl transferase [Brucella sp. BO2]
 gi|326408449|gb|ADZ65514.1| UbiA prenyltransferase [Brucella melitensis M28]
 gi|326538164|gb|ADZ86379.1| 4-hydroxybenzoate polyprenyl transferase [Brucella melitensis
           M5-90]
          Length = 333

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 139/284 (48%), Positives = 172/284 (60%), Gaps = 2/284 (0%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTI--FWYLFIYIVGAIVTR 78
           PY  LARW    GW L + PC WST L A    +AG   WS +  FW+LF+++VGAI  R
Sbjct: 38  PYAQLARWDRPIGWQLLLWPCWWSTALVAGAGAKAGDGAWSVLPSFWHLFLFLVGAIAMR 97

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT+NDLVD +ID +V RTRSRPLPSGQ TR QA +F VLQ L+   ++LQFN F + 
Sbjct: 98  GAGCTYNDLVDQEIDDKVDRTRSRPLPSGQVTRKQAKLFVVLQALVGLAVVLQFNWFSVG 157

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +G   L I   YPF KR    PQ VLG+ F+ G  +GW A   S S P   L IG I W 
Sbjct: 158 LGIFSLLIVAAYPFMKRITDWPQFVLGLAFSWGALMGWAATEGSLSLPPVLLYIGAILWT 217

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+YAHQDK+DD L+GV STARLF   TK  L +LYG  +  F  AF +  V   A 
Sbjct: 218 IGYDTIYAHQDKEDDALVGVRSTARLFGKHTKTALMVLYGGAIGFFAAAFAVAQVPMPAL 277

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
            GLL A     ++I+ LDI    QC   F S  +VG LI + L+
Sbjct: 278 AGLLAAGAHLYRQILVLDIDNPDQCLRLFKSNNIVGWLIFLGLV 321


>gi|148559160|ref|YP_001258437.1| 4-hydroxybenzoate polyprenyltransferase [Brucella ovis ATCC 25840]
 gi|148370417|gb|ABQ60396.1| 4-hydroxybenzoate polyprenyl transferase [Brucella ovis ATCC 25840]
          Length = 333

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 139/284 (48%), Positives = 171/284 (60%), Gaps = 2/284 (0%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTI--FWYLFIYIVGAIVTR 78
           PY  LARW    GW L   PC WST L A    +AG   WS +  FW+LF+++VGAI  R
Sbjct: 38  PYAQLARWDRPIGWQLLFWPCWWSTALVAGAGAKAGDGAWSVLPSFWHLFLFLVGAIAMR 97

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT+NDLVD +ID +V RTRSRPLPSGQ TR QA +F VLQ L+   ++LQFN F + 
Sbjct: 98  GAGCTYNDLVDQEIDDKVDRTRSRPLPSGQVTRKQAKLFVVLQALVGLAVVLQFNWFSVG 157

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +G   L I   YPF KR    PQ VLG+ F+ G  +GW A   S S P   L IG I W 
Sbjct: 158 LGIFSLLIVAAYPFMKRITDWPQFVLGLAFSWGALMGWAATEGSLSLPPVLLYIGAILWT 217

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+YAHQDK+DD L+GV STARLF   TK  L +LYG  +  F  AF +  V   A 
Sbjct: 218 IGYDTIYAHQDKEDDALVGVRSTARLFGKHTKTALMVLYGGAIGFFAAAFAVAQVPMPAL 277

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
            GLL A     ++I+ LDI    QC   F S  +VG LI + L+
Sbjct: 278 AGLLAAGAHLYRQILVLDIDNPDQCLRLFKSNNIVGWLIFLGLV 321


>gi|49473991|ref|YP_032033.1| prenyltransferase [Bartonella quintana str. Toulouse]
 gi|49239494|emb|CAF25847.1| 4-hydroxybenzoate-octaprenyl transferase [Bartonella quintana str.
           Toulouse]
          Length = 334

 Score =  235 bits (599), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 126/286 (44%), Positives = 168/286 (58%), Gaps = 3/286 (1%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLA--AYPLRRAGVLGW-STIFWYLFIYIVGAIVTR 78
           Y  LARW    GW L + PC WST +A  +Y + R  +L       WYLF++ +G++  R
Sbjct: 39  YAQLARWDRPIGWQLLMWPCFWSTTMALLSYEMHRYPLLSMLMNWLWYLFLFFLGSVAMR 98

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CTWNDL+DH IDSQV RTRSRPLP+G  +RFQA VF ++Q L+   +L QFN F   
Sbjct: 99  GAGCTWNDLIDHKIDSQVKRTRSRPLPTGHVSRFQAKVFILVQCLVGLGVLSQFNRFSFF 158

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +G + L    LYPF KR    PQ  LG+ F  G  +GW  +  S SW   FL +G+I W 
Sbjct: 159 LGISSLVAVALYPFMKRVTYWPQFFLGVAFNWGALMGWSVVCGSLSWAPIFLYMGSILWT 218

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+YAHQDK+DD  +GV STA LF   TK  L  LY  F++   +AF L  V  F++
Sbjct: 219 IGYDTIYAHQDKEDDATVGVFSTALLFGKGTKHALVFLYSGFLVLVSLAFYLAQVPVFSF 278

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           +GL +A      +I  +DI  S QC   F S   +G ++   L+ S
Sbjct: 279 LGLFVASIHMFIQIKVIDIDDSSQCLKLFKSNSFIGFVVFAGLVCS 324


>gi|254718595|ref|ZP_05180406.1| 4-hydroxybenzoate polyprenyltransferase [Brucella sp. 83/13]
 gi|265983571|ref|ZP_06096306.1| prenyltransferase [Brucella sp. 83/13]
 gi|306839887|ref|ZP_07472685.1| 4-hydroxybenzoate polyprenyl transferase [Brucella sp. NF 2653]
 gi|264662163|gb|EEZ32424.1| prenyltransferase [Brucella sp. 83/13]
 gi|306405073|gb|EFM61354.1| 4-hydroxybenzoate polyprenyl transferase [Brucella sp. NF 2653]
          Length = 333

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 139/284 (48%), Positives = 172/284 (60%), Gaps = 2/284 (0%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTI--FWYLFIYIVGAIVTR 78
           PY  LARW    GW L + PC WST L A    +AG   WS +  FW+LF+++VGAI  R
Sbjct: 38  PYAQLARWDRPIGWQLLLWPCWWSTALVAGAGAKAGDGAWSVLPSFWHLFLFLVGAIAMR 97

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT+NDLVD +ID +V RTRSRPLPSGQ TR QA +F VLQ L+   ++LQFN F + 
Sbjct: 98  GAGCTYNDLVDQEIDDKVDRTRSRPLPSGQVTRKQAKLFVVLQALVGLAVVLQFNWFSVG 157

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +G   L I   YPF KR    PQ VLG+ F+ G  +GW A   S S P   L IG I W 
Sbjct: 158 LGIFSLLIVAAYPFMKRITDWPQFVLGLAFSWGALMGWAATEGSLSLPPVLLYIGAILWT 217

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+YAHQDK+DD L+GV STARLF   TK  L +LYG  +  F  AF +  V   A 
Sbjct: 218 IGYDTIYAHQDKEDDALVGVRSTARLFGKHTKTALMVLYGGAIGFFAAAFAVAQVPMPAL 277

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
            GLL A     ++I+ LDI    QC   F S  +VG LI + L+
Sbjct: 278 AGLLAAGAHLYRQILVLDIDNPDQCLWLFKSNNIVGWLIFLGLV 321


>gi|118590712|ref|ZP_01548113.1| 4-hydroxybenzoate octaprenyltransferase [Stappia aggregata IAM
           12614]
 gi|118436688|gb|EAV43328.1| 4-hydroxybenzoate octaprenyltransferase [Stappia aggregata IAM
           12614]
          Length = 318

 Score =  234 bits (598), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 125/286 (43%), Positives = 166/286 (58%), Gaps = 6/286 (2%)

Query: 9   WVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLF 68
           WV D  + + + PY  LARW    GW L + PC WS  LAA     AG   W  + W++ 
Sbjct: 23  WV-DTRLPAGLRPYARLARWERPIGWWLLLWPCFWSAALAAI----AGGKAWPDL-WHMG 76

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           ++ +GA+  RGA CT+NDLVD DIDS+V RTRSRP+P+GQ ++ QA +F V+Q LI   +
Sbjct: 77  LFFIGAVAMRGAGCTYNDLVDVDIDSKVERTRSRPIPAGQVSKLQAKIFLVVQALIGLAV 136

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           LLQFN + I +G A L    +YPF KR    PQ+ LG  F+ G  +GW A   S SW   
Sbjct: 137 LLQFNTYTIWLGIASLLPVAIYPFMKRITNWPQLFLGFAFSWGALMGWAAAFGSLSWSPL 196

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAF 248
           FL +G I W + +DT+YAHQDK+DD L+GV STARLF   TK  L +LY      F +A 
Sbjct: 197 FLYVGGICWTIGYDTIYAHQDKEDDALVGVKSTARLFGEHTKPALILLYSCATALFFMAA 256

Query: 249 CLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVG 294
                   A++G+L+ +     +I+ LDI    QC   F S    G
Sbjct: 257 MFADAGPAAFVGILVGVVHLGWQIVVLDIDDGDQCLQLFRSNSTYG 302


>gi|163867867|ref|YP_001609071.1| 4-hydroxybenzoate polyprenyltransferase [Bartonella tribocorum CIP
           105476]
 gi|161017518|emb|CAK01076.1| 4-hydroxybenzoate octaprenyltransferase [Bartonella tribocorum CIP
           105476]
          Length = 334

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 127/287 (44%), Positives = 167/287 (58%), Gaps = 9/287 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLA--AYPLRRAGVLGWSTIF----WYLFIYIVGAI 75
           Y  LARW    GW L + PC WST +A  ++ +    +L    IF    WYLF++ +G+I
Sbjct: 39  YAQLARWDRPIGWQLLMWPCFWSTTMAFLSHDMHDKPLL---PIFLHWVWYLFLFFLGSI 95

Query: 76  VTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPF 135
             RGA CTWNDLVDH IDSQV RTRSRPLP+G  +RFQA VF ++Q L+   +L QFN F
Sbjct: 96  AMRGAGCTWNDLVDHKIDSQVERTRSRPLPTGHVSRFQAKVFILVQCLVGLGVLSQFNTF 155

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTI 195
              +G + L     YPF KR    PQ  LG+ F  G  +GW  +  S SW    L +G+I
Sbjct: 156 SFFLGISSLIAVAFYPFMKRVTYWPQFFLGVAFNWGALMGWAVVFGSLSWAPILLYVGSI 215

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT+YAHQDK+DD  +G+ STA LF   TK  L  LYG FV+   +AF L  V  
Sbjct: 216 LWTIGYDTIYAHQDKEDDATVGIGSTALLFGKGTKRALVFLYGGFVIFVSLAFYLAKVPL 275

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
            +++G+L A      +I  +DI  S QC   F S  ++G LI   L+
Sbjct: 276 LSFLGILAASIHMFIQIKVIDIDDSSQCLRLFKSNSLIGFLIFAGLV 322


>gi|240850075|ref|YP_002971468.1| 4-hydroxybenzoate-octaprenyl transferase UbiA [Bartonella grahamii
           as4aup]
 gi|240267198|gb|ACS50786.1| 4-hydroxybenzoate-octaprenyl transferase UbiA [Bartonella grahamii
           as4aup]
          Length = 334

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 125/287 (43%), Positives = 169/287 (58%), Gaps = 9/287 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLA--AYPLRRAGVLGWSTIF----WYLFIYIVGAI 75
           Y  LARW    GW L + PC WST +A  +Y +    +L   ++F    WYLF++ +G+I
Sbjct: 39  YAQLARWDRPIGWQLLMWPCFWSTTMAFFSYDMHYDTLL---SMFLHWVWYLFLFFLGSI 95

Query: 76  VTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPF 135
             RGA CTWNDL+DH ID+QV RTRSRPLP+G  +RFQA VF ++Q L+  V+L QFN F
Sbjct: 96  AMRGAGCTWNDLIDHKIDAQVERTRSRPLPTGHVSRFQARVFILIQCLVGLVVLSQFNRF 155

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTI 195
              +G + L     YPF KR    PQ  LG+ F  G  +GW  +  S SW    L +G+I
Sbjct: 156 SFFLGISSLIAVAFYPFMKRVTYWPQFFLGVAFNWGALMGWAVVFGSLSWAPILLYVGSI 215

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT+YAHQDK+DD  +GV STA LF   TK  L  LYG FV+   +AF L  V  
Sbjct: 216 LWTIGYDTIYAHQDKEDDATVGVRSTALLFGKGTKRALVFLYGGFVVFVSLAFYLAGVPV 275

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
            +++G+ +A      +I  +DI  S QC   F S  ++G +I   L+
Sbjct: 276 LSFLGIFMASIHMFIQIKVIDIDDSSQCLRLFKSNSLIGFVIFAGLV 322


>gi|319784737|ref|YP_004144213.1| 4-hydroxybenzoate polyprenyl transferase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317170625|gb|ADV14163.1| 4-hydroxybenzoate polyprenyl transferase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 329

 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 139/299 (46%), Positives = 177/299 (59%), Gaps = 3/299 (1%)

Query: 6   NFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAA--YPLRRAGVLGWSTI 63
           N  WV   ++  +I PY  LARW    GW L + PC WS  LAA  YP     +L     
Sbjct: 20  NGHWVYR-VLPRSIWPYAQLARWDRPIGWQLLLWPCWWSAALAASAYPRPGDPLLSLLPA 78

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
             YL +++VGAI  RGA CT+NDLVD DID+QV RTRSRPLPSG+ TR +A +F VLQ L
Sbjct: 79  PLYLVLFLVGAIAMRGAGCTYNDLVDEDIDNQVERTRSRPLPSGKATRRRAWLFLVLQAL 138

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           +  V+L+QFN F + +G   L +  +YPF KR    PQ+VLG+ F+ G  +GW       
Sbjct: 139 VGLVVLIQFNSFAVLLGICSLAVIAIYPFMKRITNWPQLVLGLAFSWGALMGWAVEFGDL 198

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
             PA  L IG+I WV+ +DT+YAHQDK+DD ++GV STARLF   TK WL  LYG  ++C
Sbjct: 199 DGPAVMLYIGSILWVIGYDTIYAHQDKEDDAIVGVRSTARLFGDNTKAWLAGLYGGALIC 258

Query: 244 FMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           F +AF        A  GL+ A     ++I  LDI    QC   F S   VG LI + LI
Sbjct: 259 FAIAFASAQAPVVALAGLIAAGAHMARQIAVLDIDNPDQCLRLFRSNNQVGWLIFLGLI 317


>gi|49475225|ref|YP_033266.1| prenyltransferase [Bartonella henselae str. Houston-1]
 gi|49238030|emb|CAF27237.1| 4-hydroxybenzoate-octaprenyl transferase [Bartonella henselae str.
           Houston-1]
          Length = 334

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 125/287 (43%), Positives = 167/287 (58%), Gaps = 9/287 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLA--AYPLRRAGVL----GWSTIFWYLFIYIVGAI 75
           Y  LARW    GW L + PC WST +A  ++ ++R  +L     W    WYLF++ +G+I
Sbjct: 39  YAQLARWDRPIGWQLLMWPCFWSTTMAFLSHEMQRVPLLPMLMNW---LWYLFLFFLGSI 95

Query: 76  VTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPF 135
             RGA CTWNDL+DH IDSQV RTRSRPLP+G  +RFQA VF ++Q L+   +L QFN F
Sbjct: 96  AMRGAGCTWNDLIDHKIDSQVERTRSRPLPTGHVSRFQAKVFILVQCLVGLGVLSQFNRF 155

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTI 195
              +G + L    LYPF KR    PQ  LG+ F  G  +GW  +  S SW    L +G+I
Sbjct: 156 SFFLGISSLVAVALYPFMKRVTYWPQFFLGVAFNWGALMGWAGICGSLSWAPILLYVGSI 215

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT+YAHQDK+DD  +GV STA LF   TK  L  LY  F++   +AF L  V  
Sbjct: 216 LWTIGYDTIYAHQDKEDDATVGVLSTALLFGKGTKCALVCLYSGFLVFVSLAFYLAQVPL 275

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
            ++ GL +A      +I  +DI  S QC   F S   +G +I + L+
Sbjct: 276 ISFFGLFVASIHMFIQIKVIDIDDSSQCLKLFKSNSFIGFVIFVGLV 322


>gi|13476189|ref|NP_107759.1| 4-hydroxybenzoate polyprenyltransferase [Mesorhizobium loti
           MAFF303099]
 gi|14026949|dbj|BAB53545.1| 4-hydroxybenzoate-octaprenyl transferase [Mesorhizobium loti
           MAFF303099]
          Length = 327

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 138/299 (46%), Positives = 176/299 (58%), Gaps = 3/299 (1%)

Query: 6   NFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAA--YPLRRAGVLGWSTI 63
           N  WV   ++  ++ PY  LARW    GW L + PC WS  LAA  YP     +L     
Sbjct: 18  NGHWVYR-VLPRSVWPYAQLARWDRPIGWQLLLWPCWWSAALAASAYPRPGDPLLSLLPA 76

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
             YL +++VGAI  RGA CT+ND+VD +ID+QV RTRSRPLPSGQ TR +A +F VLQ L
Sbjct: 77  PLYLVLFLVGAIAMRGAGCTYNDIVDENIDNQVDRTRSRPLPSGQTTRRRAWLFLVLQAL 136

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           +   +LLQFN F I +G   L I  +YPF KR    PQ+ LG+ F+ G  +GW       
Sbjct: 137 VGLAVLLQFNSFAILLGICSLAIVAIYPFMKRITNWPQLFLGLAFSWGALMGWAVEFGDL 196

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
             PA  L IG+I WV+ +DT+YAHQDK+DD ++GV STARLF   TK WL  LYG  ++C
Sbjct: 197 DGPAIMLYIGSILWVIGYDTIYAHQDKEDDAIVGVRSTARLFGDNTKSWLAGLYGGTLIC 256

Query: 244 FMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           F +AF        A  GL+ A     ++I  LDI+   QC   F S   VG LI + LI
Sbjct: 257 FAIAFASAQAPVVALAGLIAAGAHMARQIAVLDINDPDQCLRLFRSNNQVGWLIFLGLI 315


>gi|90420140|ref|ZP_01228048.1| 4-hydroxybenzoate polyprenyl transferase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90335474|gb|EAS49224.1| 4-hydroxybenzoate polyprenyl transferase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 339

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 128/290 (44%), Positives = 166/290 (57%), Gaps = 6/290 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LARW    GW L + PC WS  LA   +    V       W+L ++++GAI  RGA
Sbjct: 38  PYAQLARWDRPIGWQLLLWPCWWSAALAPQAVAAGAVHTGLPSLWHLALFLIGAIAMRGA 97

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT+NDLVD  ID  V RTRSRPLPSG+ TR QA +F  LQ  + F++L+QFN F I +G
Sbjct: 98  GCTYNDLVDQKIDDMVARTRSRPLPSGRVTRRQAKMFLALQAAVGFLVLIQFNNFAILLG 157

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L    +YPF KRF   PQ+ LG+ F+ G  +GW     + S     L  G+I WV+ 
Sbjct: 158 IASLGTVAIYPFLKRFTDWPQLGLGLAFSWGALMGWAGYWGTLSLAPVLLYTGSILWVIG 217

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLL------TVN 254
           +DT+YAHQDK+DD L+GV STARLF  +TK  L ILY   +  F+ AF          V+
Sbjct: 218 YDTIYAHQDKEDDALVGVRSTARLFGERTKGALTILYLGTLALFLAAFVSTGQASGGGVS 277

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           + A+ GL I  F  I +I  LDI    QC   F S  + G ++   LI+S
Sbjct: 278 WPAYAGLAIGAFQMIWQIRTLDIDDPDQCLGLFKSNTIFGWIVFFGLIVS 327


>gi|260460340|ref|ZP_05808592.1| 4-hydroxybenzoate polyprenyl transferase [Mesorhizobium
           opportunistum WSM2075]
 gi|259033985|gb|EEW35244.1| 4-hydroxybenzoate polyprenyl transferase [Mesorhizobium
           opportunistum WSM2075]
          Length = 329

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 137/299 (45%), Positives = 173/299 (57%), Gaps = 3/299 (1%)

Query: 6   NFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAA--YPLRRAGVLGWSTI 63
           N  WV   ++  ++ PY  LARW    GW L + PC WS  LAA  YP     +L     
Sbjct: 20  NGHWVYR-VLPRSVWPYAQLARWDRPIGWQLLLWPCWWSAALAASAYPRPGDPLLSLLPA 78

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
             YL ++++GAI  RGA CT+NDLVD  ID+QV RTRSRPLPSGQ TR +A +F VLQ L
Sbjct: 79  PLYLVLFLIGAIAMRGAGCTYNDLVDEGIDNQVERTRSRPLPSGQTTRRRAWLFLVLQAL 138

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
               +L+QFN F I +G   L I  +YPF KR    PQ+ LG+ F+ G  +GW       
Sbjct: 139 AGLAVLMQFNSFAILLGVCSLAIVAVYPFMKRITNWPQLFLGLAFSWGALMGWAVEFGDL 198

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
             PA  L IG+I WV+ +DT+YAHQDK+DD ++GV STARLF   TK WL  LYG  ++C
Sbjct: 199 DGPAIMLYIGSILWVIGYDTIYAHQDKEDDAIVGVRSTARLFGDNTKAWLAGLYGGTLIC 258

Query: 244 FMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           F +AF        A  GL+ A     ++I  LDI    QC   F S   VG LI + LI
Sbjct: 259 FAIAFASAQAPVVALAGLIAAGAHMARQITVLDIDNPDQCLRLFRSNNQVGWLIFLGLI 317


>gi|114705590|ref|ZP_01438493.1| 4-hydroxybenzoate octaprenyltransferase [Fulvimarina pelagi
           HTCC2506]
 gi|114538436|gb|EAU41557.1| 4-hydroxybenzoate octaprenyltransferase [Fulvimarina pelagi
           HTCC2506]
          Length = 327

 Score =  222 bits (565), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 125/290 (43%), Positives = 169/290 (58%), Gaps = 2/290 (0%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
            A+ PY  LARW    GW L + PC WS  LA        V        +LF+++VGAI 
Sbjct: 30  QALWPYAQLARWDRPIGWQLLMWPCWWSAALAPLAAPTTAVHMGLPDLSHLFLFLVGAIA 89

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT+NDLVD +ID+ V RTRSRPLPSG+ +R  A +F V Q L  F++L+QFNPF 
Sbjct: 90  MRGAGCTYNDLVDEEIDASVARTRSRPLPSGRISRRDAKLFMVAQSLTGFLVLVQFNPFA 149

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I +G A L    +YPF KRF   PQ+ LG+ F+ G  +GW     S S     L +G+I 
Sbjct: 150 ILLGIASLGAVAIYPFLKRFTDWPQLGLGLAFSWGALMGWACYWGSLSLAPVLLYLGSIL 209

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLL--TVN 254
           WV+ +DT+YAHQDK+DD L+GV STA+LF  +TK  + +LYG  V+ F +AF      V 
Sbjct: 210 WVIGYDTIYAHQDKEDDALVGVRSTAQLFGAKTKQAIVLLYGGAVVLFFLAFAFTGNGVG 269

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           + A++GL +       +I +LDI    +C   F S    G ++   L+ S
Sbjct: 270 WPAYLGLALGAGQMGWQIRSLDIDNPSECLRLFKSNSAFGWILFFGLVFS 319


>gi|254471951|ref|ZP_05085352.1| 4-hydroxybenzoate polyprenyl transferase [Pseudovibrio sp. JE062]
 gi|211959153|gb|EEA94352.1| 4-hydroxybenzoate polyprenyl transferase [Pseudovibrio sp. JE062]
          Length = 333

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 131/296 (44%), Positives = 170/296 (57%), Gaps = 6/296 (2%)

Query: 9   WVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLF 68
           WV D  + + + P+  LARW    GW+L + PCLWS  LA+     AG        WY  
Sbjct: 37  WV-DTRLPAGLRPFARLARWERPIGWYLLMWPCLWSLALAS---NAAGAP--IPNIWYAI 90

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           +  +GA+  RGA CT+ND+VD DID +V RTRSRP+PSGQ T  QA +F +LQ L   ++
Sbjct: 91  LMFIGAVAMRGAGCTYNDIVDKDIDDKVERTRSRPIPSGQVTSKQAKIFMILQALAGLIV 150

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           LLQFN F I +G + L I   YPF KR    PQ VLG+ F+ G  +GW A+  S S    
Sbjct: 151 LLQFNTFTIILGMSSLAIVAAYPFMKRITDWPQFVLGLAFSWGALMGWAAVFGSLSLAPV 210

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAF 248
            L  G I W + +DT+YAHQDK+DD L+GV STARLF  +T+  L ILYG  V+ F  AF
Sbjct: 211 LLYCGGIVWTIGYDTIYAHQDKEDDALVGVRSTARLFGEKTRQALVILYGATVVLFAGAF 270

Query: 249 CLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            L      A+ GL I  F    +I  LDI    QC   F S    G+++ I L++ 
Sbjct: 271 VLAGSGPLAFAGLAIGAFHLFNQIRVLDIDDGDQCLELFKSNSTFGLILFIGLVLD 326


>gi|75676746|ref|YP_319167.1| prenyltransferase [Nitrobacter winogradskyi Nb-255]
 gi|74421616|gb|ABA05815.1| 4-hydroxybenzoate octaprenyltransferase [Nitrobacter winogradskyi
           Nb-255]
          Length = 307

 Score =  219 bits (557), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 122/284 (42%), Positives = 169/284 (59%), Gaps = 5/284 (1%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R     G  L ++PCLWST LA++    AG +  S + + + ++++GA   RGA
Sbjct: 26  PYLRLSRLDRPIGSWLLLMPCLWSTALASH---LAGDV--SQLPFTIVLFLIGAFAMRGA 80

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D D+D++V RTRSRP+P+GQ T  QALVF V Q L   ++LLQFN F I  G
Sbjct: 81  GCTWNDITDRDLDARVERTRSRPIPAGQVTVTQALVFLVAQALAGLIVLLQFNRFAIATG 140

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L I   YPF KR    PQVVLG+ F+ G  +G+  +       A  L  GT+ WV+ 
Sbjct: 141 IASLLIVAAYPFMKRITYWPQVVLGLAFSWGALMGFAVVLGRIDAAALALYAGTVAWVIG 200

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQD  DD LIG+ STA LF  +T+L L I YG+ V+   VA  L    + AWIG
Sbjct: 201 YDTIYAHQDADDDALIGIKSTALLFGERTRLALAIFYGLAVVLISVALHLAEALWPAWIG 260

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           L +     + +I  ++IS ++ C   F S    G+L+   L+I 
Sbjct: 261 LAVFAAHLVWQIARIEISDARLCLRLFKSNRDAGVLLFAGLLIG 304


>gi|39934228|ref|NP_946504.1| 4-hydroxybenzoate polyprenyltransferase [Rhodopseudomonas palustris
           CGA009]
 gi|39648076|emb|CAE26596.1| putative 4-hydroxybenzoate-octaprenyl transferase [Rhodopseudomonas
           palustris CGA009]
          Length = 316

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 121/282 (42%), Positives = 161/282 (57%), Gaps = 5/282 (1%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ LAR+    G  L ++PCLWS  LAA           S +  +  ++ +G+ V RGA
Sbjct: 31  PYLRLARFDRPIGSWLLLMPCLWSAALAAGMAHD-----LSRLPLFCALFFIGSFVMRGA 85

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D D+D +V RTRSRP+P+GQ T  QA VF VL  LI  V+LLQFN F I  G
Sbjct: 86  GCTWNDITDRDLDDKVERTRSRPIPAGQVTAKQAAVFMVLLCLIGLVVLLQFNSFAIATG 145

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            + L I   YPF KR    PQ VLG+ F+ G  +G+          AF L  G+I WV+ 
Sbjct: 146 ISSLIIVAAYPFMKRITYWPQFVLGLAFSWGALMGFAGTFERLDLVAFALYAGSIAWVIG 205

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DTVYAHQD +DD ++G+ STA LF   TKL L +L+G+ V    VA  L    +FAWIG
Sbjct: 206 YDTVYAHQDAEDDLMVGIKSTALLFGENTKLALVLLFGVAVSLIGVALKLADAGWFAWIG 265

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           L       +++I+ +DI  S  C   F S    G+L+   L+
Sbjct: 266 LAAFAAHLVQQIVRVDIHDSPLCLKLFKSNRDAGLLLFGGLV 307


>gi|115522900|ref|YP_779811.1| 4-hydroxybenzoate polyprenyltransferase [Rhodopseudomonas palustris
           BisA53]
 gi|115516847|gb|ABJ04831.1| 4-hydroxybenzoate octaprenyltransferase [Rhodopseudomonas palustris
           BisA53]
          Length = 311

 Score =  213 bits (542), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 120/287 (41%), Positives = 161/287 (56%), Gaps = 5/287 (1%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R+    G  L ++PC WS  LAA   R   +L W     +  ++ +G+ V RGA
Sbjct: 27  PYLRLSRFDRPIGSWLLLMPCWWSAALAAGVARDVSLLPW-----FAALFFIGSFVMRGA 81

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D D+D +V RT+SRP+PSGQ T  QA VF VLQ L+ FV+L+QFN F I  G
Sbjct: 82  GCTWNDITDRDLDDKVERTKSRPIPSGQVTAKQAAVFMVLQCLVGFVVLIQFNGFAIATG 141

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L I   YPF KR    PQVVLG+ F+ G  +G+ A        A  L  G I WV+ 
Sbjct: 142 IASLIIVAAYPFMKRITYWPQVVLGLAFSWGALMGFAATFGRIDPAALLLYAGAISWVIG 201

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQD +DD +IG+ STA  F  +T L L   Y + VL   +A  L  V++ AW+G
Sbjct: 202 YDTIYAHQDAEDDLMIGIKSTALKFGERTHLALGFFYSLAVLLIGIALLLCEVHWPAWLG 261

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
           L        ++I  L I  S  C   F S    G+L+   L++   L
Sbjct: 262 LAAFAAHLAQQIARLKIKDSPLCLKLFKSNRDAGLLLAAGLVVDAVL 308


>gi|316932697|ref|YP_004107679.1| 4-hydroxybenzoate polyprenyl transferase [Rhodopseudomonas
           palustris DX-1]
 gi|315600411|gb|ADU42946.1| 4-hydroxybenzoate polyprenyl transferase [Rhodopseudomonas
           palustris DX-1]
          Length = 316

 Score =  213 bits (542), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 121/282 (42%), Positives = 160/282 (56%), Gaps = 5/282 (1%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ LAR+    G  L ++PCLWS  LAA           S +  +  ++ +G+ V RGA
Sbjct: 31  PYLRLARFDRPIGSWLLLMPCLWSAALAA-----GMAHDLSRLPLFCALFFIGSFVMRGA 85

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D D+D +V RTRSRP+P+GQ T  QA +F VL  LI  V+LLQFN F I  G
Sbjct: 86  GCTWNDITDRDLDDKVERTRSRPIPAGQVTARQAAMFMVLLCLIGLVVLLQFNSFAIATG 145

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L I   YPF KR    PQ VLG+ F+ G  +G+          AF L  G+I WV+ 
Sbjct: 146 IASLIIVAAYPFMKRITYWPQFVLGLAFSWGALMGFAGTFERLDLVAFALYAGSIAWVIG 205

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DTVYAHQD +DD +IG+ STA LF   TKL L +L+G+ V    VA  L    + AW+G
Sbjct: 206 YDTVYAHQDAEDDLMIGIKSTALLFGENTKLALVLLFGLAVSLIGVALKLADAGWLAWVG 265

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           L       +++I+ LDI  S  C   F S    G+L+   L+
Sbjct: 266 LAAFAAHLVQQIVRLDIHDSPLCLKLFKSNRDAGLLLFGGLV 307


>gi|218512790|ref|ZP_03509630.1| prenyltransferase [Rhizobium etli 8C-3]
          Length = 236

 Score =  212 bits (540), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 146/231 (63%)

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
           +  RGA CT+NDLVDH+ID QV RTRSRPLPSG+ TR  A +F  LQ L+   +LLQFN 
Sbjct: 1   VAMRGAGCTYNDLVDHEIDMQVARTRSRPLPSGRVTRAHAKIFIGLQALVGLFVLLQFNW 60

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT 194
           F + +G   L I  LYP++KRF   PQ  LG+ F+ G  +GW  +    S+ A  L   +
Sbjct: 61  FTVFLGLLSLGIVALYPYAKRFTDWPQFYLGLAFSWGALMGWAGILGGLSFAAVLLYAAS 120

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
           + W + +DT+YAHQDK+DDELIGV STARLF  +T+ WL  LYG+ ++   VAF L   N
Sbjct: 121 VAWTIGYDTIYAHQDKEDDELIGVRSTARLFGDRTRTWLIGLYGLTLVLMFVAFALAGAN 180

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
             A++ LL A  +   +I+ LDI  + QC + F S   VG++I   L +SL
Sbjct: 181 LIAFLALLGAAGMFAWQIVRLDIEDAAQCLALFKSNNRVGLIIFFGLFVSL 231


>gi|90426182|ref|YP_534552.1| 4-hydroxybenzoate polyprenyltransferase [Rhodopseudomonas palustris
           BisB18]
 gi|90108196|gb|ABD90233.1| 4-hydroxybenzoate octaprenyltransferase [Rhodopseudomonas palustris
           BisB18]
          Length = 310

 Score =  212 bits (539), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 117/269 (43%), Positives = 152/269 (56%), Gaps = 5/269 (1%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ LAR+    G  L +LPC WS  LAA   R       S + W+  ++ +GA   RGA
Sbjct: 26  PYLRLARFDRPIGSWLLLLPCWWSAALAAGVARDV-----SQLPWFALLFFIGAFAMRGA 80

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D D+D +V RTRSRP+P+GQ T  QA  F VLQ L+   +LLQFN F I  G
Sbjct: 81  GCTWNDITDRDLDDKVERTRSRPIPAGQVTAKQAAAFMVLQSLVGLAVLLQFNGFAIATG 140

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L I   YPF KR    PQ+VLG+ F+ G  +G+          A FL  G+I WV+ 
Sbjct: 141 IASLIIVAAYPFMKRITYWPQLVLGLAFSWGALMGFAVTLGRIDPAALFLYAGSIVWVIG 200

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQD +DD +IG+ STA LF  +T L L +LY + V    VA  L  V + AW+G
Sbjct: 201 YDTMYAHQDAEDDLMIGIKSTALLFGERTHLALSVLYALAVALIGVALLLGEVRWPAWLG 260

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHS 289
           L        ++I+ L I  S  C   F S
Sbjct: 261 LAAFAAHLAQQIVRLRIKDSPLCLRLFKS 289


>gi|192289754|ref|YP_001990359.1| 4-hydroxybenzoate polyprenyltransferase [Rhodopseudomonas palustris
           TIE-1]
 gi|192283503|gb|ACE99883.1| 4-hydroxybenzoate polyprenyl transferase [Rhodopseudomonas
           palustris TIE-1]
          Length = 316

 Score =  211 bits (538), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 123/282 (43%), Positives = 160/282 (56%), Gaps = 5/282 (1%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ LAR+    G  L ++PCLWS  LAA     A  L    +F  LF   +G+ V RGA
Sbjct: 31  PYLRLARFDRPIGSWLLLMPCLWSAALAA---GMAHDLSRLPLFCALFF--IGSFVMRGA 85

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D D+D +V RTRSRP+P+GQ T  QA VF VL  L   ++LLQFN F I  G
Sbjct: 86  GCTWNDITDRDLDDKVERTRSRPIPAGQVTAKQAAVFMVLLCLTGLIVLLQFNSFAIATG 145

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L I   YPF KR    PQ VLG+ F+ G  +G+          AF L  G+I WV+ 
Sbjct: 146 IASLIIVAAYPFMKRITYWPQFVLGLAFSWGALMGFAGTFERLDLVAFVLYAGSIAWVIG 205

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DTVYAHQD +DD ++G+ STA LF   TKL L +L+G+ V    VA  L    + AW+G
Sbjct: 206 YDTVYAHQDAEDDLMVGIKSTALLFGENTKLALVLLFGLAVSLIGVALKLADAGWLAWVG 265

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           L       +++I+ LDI  S  C   F S    G+L+   L+
Sbjct: 266 LAAFAAHLVQQIVRLDIHDSPLCLKLFKSNRDAGLLLFGGLV 307


>gi|91978575|ref|YP_571234.1| 4-hydroxybenzoate polyprenyltransferase [Rhodopseudomonas palustris
           BisB5]
 gi|91685031|gb|ABE41333.1| 4-hydroxybenzoate octaprenyltransferase [Rhodopseudomonas palustris
           BisB5]
          Length = 316

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 122/282 (43%), Positives = 158/282 (56%), Gaps = 5/282 (1%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ LAR+    G  L +LPC WS  LAA   +       S +  +  ++ VGA V RGA
Sbjct: 31  PYLRLARFDRPIGSWLLLLPCWWSAALAAGIAKDL-----SHLALFCALFFVGAFVMRGA 85

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D ++D +V RTRSRP+PSGQ T  QA  F VL  LI   +LLQFN F I  G
Sbjct: 86  GCTWNDITDRNLDGKVERTRSRPIPSGQVTARQAAAFMVLLSLIGLAVLLQFNAFAIATG 145

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            + L I   YPF KR    PQ+VLG+ F+ G  +G+    A     AF L  G+I WVV 
Sbjct: 146 ISSLIIVAAYPFMKRITYWPQIVLGLAFSWGALMGFAVTFARLDLVAFVLYAGSIVWVVG 205

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQD +DD +IG+ STA LF  +T+  L ILYG+ V     A  L    +  WIG
Sbjct: 206 YDTIYAHQDAEDDLMIGIKSTALLFGAKTQTALLILYGLAVTLIGTALMLAGSGWLGWIG 265

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           L         +I+ LDI  S+ C   F S    G+L+ I L+
Sbjct: 266 LAAFAIHLGWQIVRLDIRDSRLCLKLFKSNRDAGLLLFIGLV 307


>gi|218661875|ref|ZP_03517805.1| prenyltransferase [Rhizobium etli IE4771]
          Length = 382

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 156/292 (53%), Gaps = 11/292 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LARW    GW L + PC WS  LAA      G+   S +  +L +Y +GA+  RGA
Sbjct: 92  PYAQLARWDRPIGWQLLMWPCFWSATLAANAAIDEGLYSGSLLVSHLILYFIGAVAMRGA 151

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT+NDLVDH+ID QV RTRSRPLPSG+ TR  A                 F    +  G
Sbjct: 152 GCTYNDLVDHEIDMQVARTRSRPLPSGRVTRAHAK-----NLHRPAGAGRAFRALAVSTG 206

Query: 141 FALLFI------SLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT 194
               ++      S   P    F   PQ  LG+ F+ G  +GW  +    S+ +  L   +
Sbjct: 207 LPSSWVCSRSASSRFIPTPNVFTDWPQFYLGLAFSWGALMGWAGILGEISFASVLLYAAS 266

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
           + W + +DT+YAHQDK+DDELIGV STARLF  +T+ WL  LYG+ ++   VAF L   N
Sbjct: 267 VAWTIGYDTIYAHQDKEDDELIGVRSTARLFGDRTRAWLIGLYGLTLVLMFVAFALAGAN 326

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
             A++ LL A  +   +I+ LDI  + QC + F S   VG++I   L ISL 
Sbjct: 327 LIAFLALLGAAGMFAWQIVRLDIEDAAQCLALFKSNNRVGLIIFFGLFISLL 378


>gi|110633075|ref|YP_673283.1| prenyltransferase [Mesorhizobium sp. BNC1]
 gi|110284059|gb|ABG62118.1| 4-hydroxybenzoate octaprenyltransferase [Chelativorans sp. BNC1]
          Length = 327

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 135/279 (48%), Positives = 166/279 (59%), Gaps = 2/279 (0%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTI--FWYLFIYIVGAIVTR 78
           PY  LARW    GW L + PC WS  LA+      G      I   W+L ++++GAI  R
Sbjct: 32  PYAQLARWDRPIGWKLLLWPCWWSLALASAAGATPGTPLLDVIPSLWHLLLFLLGAIAMR 91

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT+ND+VD D+D +V RTRSRPLPSGQ +R QA  F V Q L+   +LLQFN F I 
Sbjct: 92  GAGCTYNDIVDLDVDEKVERTRSRPLPSGQVSRKQAWAFLVAQALVGLAVLLQFNGFAIL 151

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           VG A L    +YPF+KRF   PQ  LG+ F+ G  +GW     + S  AF L  G+I WV
Sbjct: 152 VGLASLLTVAVYPFAKRFTDWPQFFLGLAFSWGALMGWAVHFGALSLAAFLLYCGSILWV 211

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+YAHQDK+DD L+GV STARLF   TK WL  LYG  +L F VAF L  V   A 
Sbjct: 212 IGYDTIYAHQDKEDDALVGVRSTARLFGEHTKRWLVALYGGALLFFAVAFALAAVPMPAL 271

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
            GL+ A     ++I  LDI    QC + F S  VVG LI
Sbjct: 272 AGLVAAGAHMSRQIRVLDIDDPDQCLALFKSNSVVGWLI 310


>gi|86748972|ref|YP_485468.1| 4-hydroxybenzoate polyprenyltransferase [Rhodopseudomonas palustris
           HaA2]
 gi|86572000|gb|ABD06557.1| 4-hydroxybenzoate octaprenyltransferase [Rhodopseudomonas palustris
           HaA2]
          Length = 316

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 124/281 (44%), Positives = 156/281 (55%), Gaps = 5/281 (1%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ LAR+    G  L ++PC WS  LAA   +  G L    +F  LF   VGA V RGA
Sbjct: 31  PYLRLARFDRPIGSWLLLMPCWWSAALAAGMAKELGQL---PLFCALFF--VGAFVMRGA 85

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D D+D +V RTRSRP+P+GQ T  QA  F V    I   +LLQFN F I  G
Sbjct: 86  GCTWNDITDRDLDGKVERTRSRPIPAGQVTAKQAAAFMVTLSFIGLAVLLQFNNFTIATG 145

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L I   YPF KR    PQ+VLG+ F+ G  +G+    A     AF L  G+I WVV 
Sbjct: 146 IASLIIVAAYPFMKRITYWPQIVLGLAFSWGALMGFAGTFARLDLVAFVLYAGSIAWVVG 205

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQD +DD +IG+ STA LF  +T   L +LYG+ V     A  L    +F WIG
Sbjct: 206 YDTIYAHQDAEDDLMIGIKSTALLFGDRTHAALLVLYGLAVTLLGTALLLADSGWFGWIG 265

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICL 301
           L       + +I+ LDI  S  C   F S    G+L+ I L
Sbjct: 266 LAAFTVHLVSQIVRLDIHDSPLCLKLFKSNRDAGLLLFIGL 306


>gi|27382632|ref|NP_774161.1| 4-hydroxybenzoate polyprenyltransferase [Bradyrhizobium japonicum
           USDA 110]
 gi|27355804|dbj|BAC52786.1| 4-hydroxybenzoate octaprenyltransferase [Bradyrhizobium japonicum
           USDA 110]
          Length = 310

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 151/269 (56%), Gaps = 5/269 (1%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R+    G  L ++PC WS  LAA     +G L  + +     ++ +GA V RGA
Sbjct: 26  PYLRLSRFDRPIGSWLLLMPCWWSAALAAGIAHDSGRLPLTIV-----LFFIGAFVMRGA 80

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D D+D +V RTRSRPLPSGQ T  QAL F V Q LI  V+LLQFN F +  G
Sbjct: 81  GCTWNDITDRDLDDKVERTRSRPLPSGQVTTKQALAFMVAQALIGLVVLLQFNRFAVLTG 140

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L I  +YPF KR    PQ+VLG+ F+ G  +G+          A  L  G+I WV+ 
Sbjct: 141 IASLLIVAIYPFMKRITWWPQIVLGLAFSWGALMGFAVTFGRIDVTALVLYGGSIAWVIG 200

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQD +DD LIG+ STARLF   T   L + YG+ V+   VA     V + AW+G
Sbjct: 201 YDTIYAHQDAEDDALIGIKSTARLFGAHTHQALVLFYGLAVVLIGVALASGDVRWPAWLG 260

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHS 289
           L         +I+ L I     C   F S
Sbjct: 261 LAAFAAHLASQIVRLRIDDPALCLRLFKS 289


>gi|307941682|ref|ZP_07657037.1| 4-hydroxybenzoate polyprenyl transferase [Roseibium sp. TrichSKD4]
 gi|307775290|gb|EFO34496.1| 4-hydroxybenzoate polyprenyl transferase [Roseibium sp. TrichSKD4]
          Length = 314

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 129/296 (43%), Positives = 172/296 (58%), Gaps = 6/296 (2%)

Query: 9   WVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLF 68
           WV D  + + + PY  LARW    GW L + PCLWS  LAA     A    W    W++F
Sbjct: 19  WV-DTRLPAWLRPYARLARWERPIGWWLLLWPCLWSAALAAI----ASGAAWPNP-WHMF 72

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           ++ +GA+  RGA CT+ND+VD DID QV RTRSRP+P+GQ TR QA +F VLQ L   V+
Sbjct: 73  LFFIGAVAMRGAGCTYNDIVDEDIDGQVERTRSRPIPAGQVTRTQAKIFLVLQALTGLVV 132

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           LLQFN F I +G A L    +YPF KR    PQ+ LG  F+ G  +GW A+  S  W   
Sbjct: 133 LLQFNTFSIALGVASLVPVAIYPFMKRITNWPQLFLGFAFSWGALMGWAAVFGSLGWAPI 192

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAF 248
            L +G I W + +DT+YAHQDK+DD L+GV STA LF  +TKL L +LY    L F +A 
Sbjct: 193 PLYLGGICWTIGYDTIYAHQDKEDDALVGVRSTALLFGERTKLALVLLYLSASLLFALAA 252

Query: 249 CLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            L      A++G+   +     +I+ LDI   ++C   F S G  G ++ I  ++ 
Sbjct: 253 MLADAGPLAFMGIAAGVVHLFWQIVKLDIDQPEECLKLFRSNGKFGWIMFIGFVLD 308


>gi|298290360|ref|YP_003692299.1| 4-hydroxybenzoate polyprenyl transferase [Starkeya novella DSM 506]
 gi|296926871|gb|ADH87680.1| 4-hydroxybenzoate polyprenyl transferase [Starkeya novella DSM 506]
          Length = 316

 Score =  205 bits (522), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 113/282 (40%), Positives = 153/282 (54%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           +A+ P++ LAR     G  L ++PC WS  LA     RAG   +S       ++ VGA+ 
Sbjct: 25  AALRPFLRLARIDRPIGSWLLLIPCWWSVALALGMQARAGEADYSRALILGVLFAVGAVA 84

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CTWND++D DID +V RTR+RPLP+GQ T   A  F  LQ L+  V+L+   PF 
Sbjct: 85  MRGAGCTWNDILDRDIDVRVERTRARPLPAGQVTLLGAFAFLALQALVGLVVLICLPPFA 144

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I    A L +  +YP  KR I  PQ VLG+ F+ G  +G+ AL       AF L  G++ 
Sbjct: 145 IVTALASLGLVAIYPLMKRVIWVPQAVLGLTFSWGALMGFAALLEELPAAAFLLYAGSVL 204

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
           WV+ +DT+YAHQD++DD L+GV S+ARLF   TK WL   Y        VA        +
Sbjct: 205 WVIGYDTIYAHQDREDDALVGVKSSARLFGRATKPWLVGFYAAAAALIGVALVTAGAGPY 264

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILIL 298
           AW GL I +     ++  LDI     C   F S    G+++L
Sbjct: 265 AWGGLGIFVVQLGTQVRRLDIDDRALCLKLFKSNRDAGLILL 306


>gi|148253215|ref|YP_001237800.1| 4-hydroxybenzoate polyprenyltransferase [Bradyrhizobium sp. BTAi1]
 gi|146405388|gb|ABQ33894.1| 4-hydroxybenzoate octaprenyltransferase [Bradyrhizobium sp. BTAi1]
          Length = 310

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 144/242 (59%), Gaps = 7/242 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIF-WYLFIYIVGAIVTRG 79
           PY+ LAR+    G  L ++PC WS  LAA      G+ G  T+   ++ +Y VGA   RG
Sbjct: 26  PYLRLARYDRPIGSWLLLMPCWWSAALAA------GMSGQLTMLPAWIALYFVGAFAMRG 79

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICV 139
           A CTWND+ D D+D++V RTRSRP+P+GQ    QAL F V Q LI  ++LLQFN F I  
Sbjct: 80  AGCTWNDITDRDLDAKVERTRSRPIPAGQVGVKQALAFLVAQALIGLMVLLQFNRFAILT 139

Query: 140 GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVV 199
           G A L I  +YPF KR    PQ+VLG+ F+ G  +G+          A  L  G+I WV+
Sbjct: 140 GIASLVIVAIYPFMKRITWWPQMVLGLAFSWGALMGFAVAFGRLDATALLLYAGSIAWVI 199

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
            +DT+YAHQD +DD LIG+ STARLF+ +T L L + YG+ V+    A         AWI
Sbjct: 200 AYDTIYAHQDAEDDALIGIKSTARLFADRTHLALILFYGLAVVLIGAALVTAHAGVAAWI 259

Query: 260 GL 261
           GL
Sbjct: 260 GL 261


>gi|299134208|ref|ZP_07027401.1| 4-hydroxybenzoate polyprenyl transferase [Afipia sp. 1NLS2]
 gi|298590955|gb|EFI51157.1| 4-hydroxybenzoate polyprenyl transferase [Afipia sp. 1NLS2]
          Length = 311

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 120/285 (42%), Positives = 164/285 (57%), Gaps = 7/285 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVL-GWSTIFWYLFIYIVGAIVTRG 79
           PY+ LAR     G  L ++PCLWS  LAA      GV    S +   L ++ +GA+V RG
Sbjct: 26  PYLRLARMDRPIGTWLLLMPCLWSAALAA------GVADNLSHLPSTLILFAIGALVMRG 79

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICV 139
           A CTWND+ D D+D++V RTRSRP+P+GQ T  QA+VF  LQ L+   +LLQFN F +  
Sbjct: 80  AGCTWNDITDRDLDAKVERTRSRPIPAGQVTAKQAVVFLALQLLVGLGVLLQFNWFAVAT 139

Query: 140 GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVV 199
           G A L + ++YPF KR    PQ VLG+ F+ G  +G+  + A     A +L  G+I WV+
Sbjct: 140 GIASLIVVVVYPFMKRITYWPQAVLGLAFSWGALMGFAVILARIDAAALWLYAGSIAWVI 199

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
            +DT+YAHQD +DD LIGV STA LF   T+ WL + YG+ V+    A         AW+
Sbjct: 200 GYDTIYAHQDTEDDALIGVKSTALLFGKNTRSWLALFYGLAVILIGAALWSAGAGLPAWL 259

Query: 260 GLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           GL +     + +II L I+ S  C   F      G+L+   L+I 
Sbjct: 260 GLAVFAAHLVSQIIRLRIADSTLCLRLFRGNRDAGLLLFAGLVID 304


>gi|92118650|ref|YP_578379.1| 4-hydroxybenzoate polyprenyltransferase [Nitrobacter hamburgensis
           X14]
 gi|91801544|gb|ABE63919.1| 4-hydroxybenzoate octaprenyltransferase [Nitrobacter hamburgensis
           X14]
          Length = 313

 Score =  201 bits (512), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 115/270 (42%), Positives = 153/270 (56%), Gaps = 7/270 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLG-WSTIFWYLFIYIVGAIVTRG 79
           PY+ L+R     G  L +LPC WS  LAA      GV    S +   + ++ +GA   RG
Sbjct: 26  PYLRLSRLDRPIGSWLLLLPCWWSAALAA------GVANDLSRLPLTIVLFFIGAFAMRG 79

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICV 139
           A CTWND+ D D+D++V RTRSRP+P+GQ T  QA VF V Q L+  V+LLQFN F I  
Sbjct: 80  AGCTWNDITDRDLDARVERTRSRPIPAGQATVAQAFVFLVAQALVGLVVLLQFNRFAIAT 139

Query: 140 GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVV 199
           G A L +  +YPF KR    PQVVLG+ F+ G  +G+  +       A  L  G+I WV+
Sbjct: 140 GIASLIVVAVYPFMKRITNWPQVVLGLAFSWGALMGFAVVLGRVDAAALALYAGSIAWVI 199

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
            +DT+YAHQD +DD LIG+ STA LF  +T+  L I YG+ V+   VA  L    + AWI
Sbjct: 200 GYDTIYAHQDTEDDALIGIKSTALLFGERTRSALAIFYGLAVVLIGVALHLAGARWPAWI 259

Query: 260 GLLIALFLTIKRIIALDISCSKQCCSFFHS 289
           GL         ++  + I  S+ C   F S
Sbjct: 260 GLAAFTTHLAWQVARIQIGDSRLCLRLFKS 289


>gi|146342921|ref|YP_001207969.1| 4-hydroxybenzoate polyprenyltransferase [Bradyrhizobium sp. ORS278]
 gi|146195727|emb|CAL79754.1| 4-hydroxybenzoate-octaprenyl transferase [Bradyrhizobium sp.
           ORS278]
          Length = 310

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 114/270 (42%), Positives = 151/270 (55%), Gaps = 7/270 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLG-WSTIFWYLFIYIVGAIVTRG 79
           PY+ LAR+    G  L ++PC WS  LA+      G+ G  S +  ++ +Y VGA   RG
Sbjct: 26  PYLRLARYDRPIGSWLLLMPCWWSAALAS------GISGDLSMLPLWVGLYFVGAFAMRG 79

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICV 139
           A CTWND+ D D+D+QV RTRSRP+P+GQ    +AL F V Q LI   +LLQFN F I  
Sbjct: 80  AGCTWNDITDRDLDAQVERTRSRPIPAGQVGVKRALAFLVAQALIGLAVLLQFNRFAILT 139

Query: 140 GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVV 199
           G A L I  +YPF KR    PQ VLG+ F+ G  +G+          A  L  G+I WV+
Sbjct: 140 GIASLLIVAIYPFMKRITWWPQTVLGLAFSWGALMGFAVAFGRLDATALLLYAGSICWVI 199

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
            +DT+YAHQD +DD LIG+ STARLF+ +T L L + Y + V+    AF    V   AW+
Sbjct: 200 AYDTIYAHQDAEDDALIGIKSTARLFAERTHLALVVFYSLAVVLIGAAFATAHVRVAAWL 259

Query: 260 GLLIALFLTIKRIIALDISCSKQCCSFFHS 289
           GL         ++  LD +    C   F S
Sbjct: 260 GLACFAAHLAWQVRRLDTADPALCLRVFKS 289


>gi|85714210|ref|ZP_01045198.1| 4-hydroxybenzoate polyprenyl transferase [Nitrobacter sp. Nb-311A]
 gi|85698657|gb|EAQ36526.1| 4-hydroxybenzoate polyprenyl transferase [Nitrobacter sp. Nb-311A]
          Length = 307

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 154/269 (57%), Gaps = 5/269 (1%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R     G  L ++PCLWS  LA++  R    L  + +     ++ +GA   RGA
Sbjct: 26  PYLRLSRLDRPIGSWLLLIPCLWSAALASHLARDVSQLPLTIV-----LFFIGAFAMRGA 80

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D D+D++V RTRSRP+P+G+ T  QALVF V+Q L+  V+LLQFNPF I  G
Sbjct: 81  GCTWNDITDRDLDARVERTRSRPIPAGKVTVTQALVFLVVQALVGLVVLLQFNPFAIATG 140

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L I   YPF KR    PQVVLG+ F+ G  +G+  +       A  L  G I WV+ 
Sbjct: 141 IASLLIVAAYPFMKRITYWPQVVLGLAFSWGALMGFAVVLGRIDAAALALYAGAIAWVIG 200

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQD  DD LIG+ STA LF  +T+  L I YG+ V+   VA  L    + AW+G
Sbjct: 201 YDTIYAHQDADDDALIGIKSTALLFGERTRSALAIFYGLAVILIGVALHLAGAEWPAWLG 260

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHS 289
           L         +I  ++I   + C   F S
Sbjct: 261 LAAFAAHLAWQIARIEIGDPRLCLRLFKS 289


>gi|304393467|ref|ZP_07375395.1| 4-hydroxybenzoate polyprenyl transferase [Ahrensia sp. R2A130]
 gi|303294474|gb|EFL88846.1| 4-hydroxybenzoate polyprenyl transferase [Ahrensia sp. R2A130]
          Length = 320

 Score =  198 bits (504), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 116/291 (39%), Positives = 162/291 (55%), Gaps = 10/291 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LARW    GW L + PC+WS  LA      AG     T+   + ++  GA+  RGA
Sbjct: 30  PYAQLARWDRPIGWKLLLWPCMWSLALA---WSVAGETIEPTLLAQIALFWAGAVAMRGA 86

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLL-------QFN 133
            CT+ND+VD DID++V RT SRP+PSG+ ++ QA VF V Q L   ++LL        FN
Sbjct: 87  GCTYNDVVDVDIDAKVARTASRPIPSGRVSKMQATVFLVAQALAGLLVLLGLCALSEPFN 146

Query: 134 PFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIG 193
            +   +  + L +   YPF+KR    PQ VLG+ F+ G  +GW  +    S P   L IG
Sbjct: 147 GYAFILACSSLGVVAFYPFAKRLTDWPQFVLGLSFSWGALMGWAVVFGELSAPPVLLYIG 206

Query: 194 TIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTV 253
           +I WV+ +DT+YAHQD++DD ++GV STARLF  +T   L ILYG  ++ F  A+    V
Sbjct: 207 SILWVIGYDTIYAHQDREDDAIVGVRSTARLFGDRTVQALLILYGGTLILFAAAYFEAGV 266

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
               +IGLL+     I +I +LDI   ++C   F S    G  +   LI +
Sbjct: 267 GAAGYIGLLVGGMHMIWQITSLDIEDGEKCLRLFRSNNFFGWAVFAGLIAN 317


>gi|209886370|ref|YP_002290227.1| 4-hydroxybenzoate polyprenyl transferase [Oligotropha
           carboxidovorans OM5]
 gi|209874566|gb|ACI94362.1| 4-hydroxybenzoate polyprenyl transferase [Oligotropha
           carboxidovorans OM5]
          Length = 311

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 134/218 (61%), Gaps = 5/218 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ LAR     G  L ++PCLWS  LAA   R       S +   L ++ +GA+V RGA
Sbjct: 26  PYLRLARMDRPIGAWLLLMPCLWSAALAAGVARDL-----SHLPVTLVLFAIGALVMRGA 80

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D D+D +V RTRSRP+P+GQ T  QA+ F  LQ LI  V+LLQFN F +  G
Sbjct: 81  GCTWNDITDRDLDGRVERTRSRPIPAGQVTVEQAVAFLGLQLLIGLVVLLQFNWFAVATG 140

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L I  +YPF KR    PQ VLG+ F+ G  +G+ A+ A     A +L  G+I WV+ 
Sbjct: 141 VASLIIVAVYPFMKRVTYWPQAVLGLAFSWGALMGFAAILARIDAAALWLYAGSIAWVIG 200

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYG 238
           +DT+YAHQD  DD LIGV STA LF   T+ WL + YG
Sbjct: 201 YDTIYAHQDTDDDALIGVKSTALLFGENTQCWLALFYG 238


>gi|328545033|ref|YP_004305142.1| 4-hydroxybenzoate-octaprenyl transferase UbiA [Polymorphum gilvum
           SL003B-26A1]
 gi|326414775|gb|ADZ71838.1| 4-hydroxybenzoate-octaprenyl transferase UbiA [Polymorphum gilvum
           SL003B-26A1]
          Length = 317

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 163/300 (54%), Gaps = 18/300 (6%)

Query: 1   MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLA------AYPLRR 54
           +S      WV D  + +   PY  LARW    GW L + PC WS  LA       YP   
Sbjct: 14  VSDAVKRHWV-DTRLPAWARPYARLARWERPIGWWLLLWPCWWSAALAAIAAEAPYPDP- 71

Query: 55  AGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA 114
                     W+L ++++GA+  RGA CT+NDLVD DID+QV RTRSRP+P+GQ TR QA
Sbjct: 72  ----------WHLALFLIGAVAMRGAGCTYNDLVDEDIDAQVERTRSRPIPAGQVTRTQA 121

Query: 115 LVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFV 174
            VF VLQ  + F++L+QFN F I +G A L    +YPF KR    PQ+ LG  F+ G  +
Sbjct: 122 KVFLVLQAFVGFLVLIQFNGFAIALGIASLATVAVYPFMKRVTDWPQLFLGFAFSWGALM 181

Query: 175 GWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLF 234
           GW A      W    L +G I W + +DT+YAHQDK+DD L+GV STARLF  +TK  L 
Sbjct: 182 GWAAAFGRLDWAPVVLYLGGICWTIGYDTIYAHQDKEDDALVGVRSTARLFGARTKPALI 241

Query: 235 ILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVG 294
            LYG     F +A  L      A++GL       + +I+ LDI    QC   F S    G
Sbjct: 242 ALYGAATGLFALAAALADAGPAAFLGLAAGAGHLVWQILVLDIDHPDQCLKLFRSNTTYG 301


>gi|114771338|ref|ZP_01448758.1| 4-hydroxybenzoate polyprenyl transferase [alpha proteobacterium
           HTCC2255]
 gi|114548263|gb|EAU51150.1| 4-hydroxybenzoate polyprenyl transferase [alpha proteobacterium
           HTCC2255]
          Length = 329

 Score =  192 bits (487), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 121/311 (38%), Positives = 170/311 (54%), Gaps = 21/311 (6%)

Query: 6   NFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWS---TVLAAYPLRRAGVLGWST 62
           N  WV D    +   PY+ L+R     G  L ++PC+WS    +L+   L+  G+     
Sbjct: 19  NKNWV-DLYAPAFSRPYLRLSRADRPAGTWLLLIPCIWSLCLAILSNDTLQSTGIK---- 73

Query: 63  IFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQF 122
              Y+ +  +GA + RGA CTWND+ D  ID++V RT+SRP+PSGQ T  QAL + ++Q 
Sbjct: 74  ---YIILMAIGAFLMRGAGCTWNDITDQKIDARVARTKSRPIPSGQITPKQALKWMLIQA 130

Query: 123 LISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHAS 182
           L   ++L  FN F I +G   L    +YPF+KRF   PQ+ LG+ F  G  +GW A   S
Sbjct: 131 LAGALVLFTFNKFTIVLGIFALVPVAIYPFAKRFTWWPQLFLGVAFNWGALIGWSAQIGS 190

Query: 183 FSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIF 240
            S     L +  I W +++DT+YAHQDK+DD LIGV STARLF   TK WL  F++  I 
Sbjct: 191 LSLSPILLYLAGISWTLFYDTIYAHQDKEDDALIGVRSTARLFHSNTKKWLWCFLILSIS 250

Query: 241 VL--CFMVAFCLLTVNFFAWIGLLIALFLTIK---RIIALDISCSKQCCSFFHS---AGV 292
           ++   F+VA       F+  IG+   L   I    ++  LDI+ +  C   F S   AG+
Sbjct: 251 LMIGAFVVALQNNVNVFYFMIGISGILAFGIHLIWQLKNLDINSADNCLMIFRSNRNAGL 310

Query: 293 VGILILICLII 303
           + IL   C II
Sbjct: 311 LPILGFTCAII 321


>gi|296444349|ref|ZP_06886314.1| 4-hydroxybenzoate polyprenyl transferase [Methylosinus
           trichosporium OB3b]
 gi|296257996|gb|EFH05058.1| 4-hydroxybenzoate polyprenyl transferase [Methylosinus
           trichosporium OB3b]
          Length = 316

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 139/242 (57%), Gaps = 6/242 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           P+V LAR     GW L +LPC   + LA+        LG      +L ++ +GA+  RGA
Sbjct: 30  PFVQLARLDRPIGWQLLLLPCWEGSALAS------AALGRPLDLLHLILFFIGAVSMRGA 83

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
             T+ND+VD DID++V RTR RPL SG+ +   A+VF VLQ L+   +LL FN F I + 
Sbjct: 84  GSTYNDIVDRDIDAKVERTRGRPLASGRASLRAAIVFLVLQCLVGLGVLLSFNGFTIALA 143

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
           FA   I L+YPF+KR    PQ VLG+ FA G  +GW A   +  WPA  L +  I W + 
Sbjct: 144 FASPLIVLIYPFAKRITSWPQAVLGLAFAYGALLGWTAQAGALGWPAVLLYLAAILWTIG 203

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YA QDK+DD + GV STA LF  + +L +  LY    LC  +A     +   A +G
Sbjct: 204 YDTIYALQDKRDDVIAGVRSTALLFGARVRLAVGTLYAASALCAELAVLTAHLGVAAHLG 263

Query: 261 LL 262
           +L
Sbjct: 264 VL 265


>gi|154251109|ref|YP_001411933.1| 4-hydroxybenzoate polyprenyl transferase [Parvibaculum
           lavamentivorans DS-1]
 gi|154155059|gb|ABS62276.1| 4-hydroxybenzoate polyprenyl transferase [Parvibaculum
           lavamentivorans DS-1]
          Length = 340

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 106/282 (37%), Positives = 151/282 (53%), Gaps = 9/282 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ LAR     G  L +LPC WS  LA       G++          I+ +GAIV RGA
Sbjct: 63  PYMRLARLDRPIGTWLLLLPCWWSIALAGDAGPDLGLM---------LIFAIGAIVMRGA 113

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D +ID+ V RTRSRP+PSG  +   A +F   Q L    +LL  N F I +G
Sbjct: 114 GCTWNDIADRNIDAAVERTRSRPIPSGAVSVKAAWIFLAAQCLAGLAVLLSLNAFTIALG 173

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L +  +YPF KR    PQ+VLG+ F  G  +GW A+  S +     L +G IFW V 
Sbjct: 174 LASLALVAIYPFMKRVTYWPQIVLGLAFNWGALMGWAAVTGSLALAPALLYLGAIFWTVG 233

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQDK DD LIGV S+A      T+ WL++ YG  +   + +    ++  F ++G
Sbjct: 234 YDTIYAHQDKDDDALIGVKSSALKLGASTRKWLWVFYGAMIAALVASGAAASIGMFFYLG 293

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           + +A    + +I+ LD+     C   F S    G ++   ++
Sbjct: 294 VALAALQLVWQIVKLDVDDPALCLHLFRSNRDFGFIVFAAIV 335


>gi|254500778|ref|ZP_05112929.1| 4-hydroxybenzoate polyprenyl transferase [Labrenzia alexandrii
           DFL-11]
 gi|222436849|gb|EEE43528.1| 4-hydroxybenzoate polyprenyl transferase [Labrenzia alexandrii
           DFL-11]
          Length = 354

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 122/291 (41%), Positives = 172/291 (59%), Gaps = 6/291 (2%)

Query: 9   WVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLF 68
           WV D  + + + PY  LARW    GW L + PC WS  LAA     +    W    W++ 
Sbjct: 57  WV-DTRLPAGLRPYARLARWERPIGWWLLLWPCWWSAALAAIAAGNS----WPNP-WHML 110

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           ++++GAI  RGA CT+ND+VD DID+QV RTRSRP+P+GQ ++ QA +F V+Q L+  ++
Sbjct: 111 LFLIGAIAMRGAGCTYNDIVDVDIDAQVERTRSRPIPAGQVSKRQAKIFLVVQALVGLLV 170

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           LLQFN F I +G A L    +YPF KR    PQ+ LG  F+ G  +GW A+    S    
Sbjct: 171 LLQFNSFSIALGIASLIPVAIYPFMKRITNWPQLFLGFAFSWGALMGWAAVFGDLSLAPI 230

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAF 248
            L IG I W + +DT+YAHQDK+DD L+GV STARLF  +T+L L +LY +  + F +A 
Sbjct: 231 LLYIGGICWTIGYDTIYAHQDKEDDALVGVKSTARLFGDRTRLALIVLYALASILFALAA 290

Query: 249 CLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILI 299
            L      A++G+L+       +I+ +DI    QC   F S  + G ++ I
Sbjct: 291 ALADAGPAAFLGILLGAIHLGWQIVIIDIDDGDQCLQLFRSNKIYGWVLFI 341


>gi|300024090|ref|YP_003756701.1| 4-hydroxybenzoate polyprenyl transferase [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299525911|gb|ADJ24380.1| 4-hydroxybenzoate polyprenyl transferase [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 320

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 108/290 (37%), Positives = 151/290 (52%), Gaps = 5/290 (1%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L R+    G  L + PC WS  LA    R          F  + ++ +GA   R +
Sbjct: 32  PYLRLGRFDRPIGAWLLLFPCWWSLTLAQVASREP-----FPDFRSILLFTIGAFAMRAS 86

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C +ND VD  ID++V RT SRP+PSGQ T   AL F V+  L+   +LLQFN F + +G
Sbjct: 87  GCAYNDYVDRFIDAKVQRTASRPIPSGQVTPAGALKFVVVMALVGLAVLLQFNWFTVWLG 146

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L I  +YPF+KR    PQ+VLG+ F  G  VGW A   S  WPA  L  G + W V 
Sbjct: 147 IASLLIVAVYPFAKRVTSYPQIVLGLAFNWGALVGWAAEKGSLDWPAVALYAGCVLWTVG 206

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQDK+DD L+G+ STA  F   T  ++   YG+  + ++ A  L   +   ++ 
Sbjct: 207 YDTIYAHQDKEDDALLGLGSTALHFGDNTVSYVGAFYGLAGILWLTAGALAGAHLVYFLS 266

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
           + +       ++  LDI     C   F S   VGI + + LI  + L  F
Sbjct: 267 VTLVFLQMSWQVATLDIDDPSNCLRRFKSNRDVGIAVFLGLIADMSLSWF 316


>gi|154245433|ref|YP_001416391.1| 4-hydroxybenzoate polyprenyl transferase [Xanthobacter
           autotrophicus Py2]
 gi|154159518|gb|ABS66734.1| 4-hydroxybenzoate polyprenyl transferase [Xanthobacter
           autotrophicus Py2]
          Length = 323

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 109/297 (36%), Positives = 154/297 (51%), Gaps = 17/297 (5%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAA------YPLRRAGVLGWSTIFWYLFIYIV 72
           + PY+ LAR     G  L +LPC WST LAA      YP  R            L ++ +
Sbjct: 31  VRPYLRLARLDRPIGSWLLLLPCWWSTALAAIADDAPYPDPR-----------LLVLFAI 79

Query: 73  GAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQF 132
           GA+  RGA CTWND++D  ID QV RTR+RP+ SG  +   A  F V Q LI   +LL  
Sbjct: 80  GAVAMRGAGCTWNDILDRKIDQQVARTRNRPVASGAVSVPAAFAFLVAQALIGLAVLLSL 139

Query: 133 NPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI 192
             F I  G A L +  +YP  KR    PQ++LGI F+ G  +GW ++  + + PA  L  
Sbjct: 140 PHFAIITGLASLGVVAIYPLMKRVTSVPQLILGIAFSWGALMGWASVMRTITDPALLLFA 199

Query: 193 GTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLT 252
           G + WV  +DT+YAHQDK+DD + GV STA LF   T L + + Y + V+ F +A   + 
Sbjct: 200 GCVLWVFAYDTIYAHQDKEDDAIAGVRSTALLFGRGTALVVALCYTLVVVLFGIALLSVP 259

Query: 253 VNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQ 309
              FA +GL+        ++  LDI    +C + F S    G+++   L +   +  
Sbjct: 260 SGPFAVMGLIGFALHLAGQVRRLDIDDGARCLAVFKSNRDAGLILFAGLALDTLVPN 316


>gi|158424002|ref|YP_001525294.1| 4-hydroxybenzoate polyprenyl transferase [Azorhizobium caulinodans
           ORS 571]
 gi|158330891|dbj|BAF88376.1| 4-hydroxybenzoate polyprenyl transferase [Azorhizobium caulinodans
           ORS 571]
          Length = 325

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 113/307 (36%), Positives = 160/307 (52%), Gaps = 24/307 (7%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAA------YPLRRAGVLGWS 61
            WV D    +A+ PY+ LAR     G  L ++PC WST LAA      YP  +       
Sbjct: 24  NWV-DRHAPAALRPYLRLARLDRPIGSWLLLMPCWWSTALAAGAAHQPYPDPK------- 75

Query: 62  TIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQ 121
                L ++ +GA+  RGA CTWND++D  ID  V RT++RP+ SG  +   A+ F V Q
Sbjct: 76  ----LLILFAIGAVAMRGAGCTWNDILDRKIDRMVARTQNRPVASGAVSVPAAMAFLVFQ 131

Query: 122 FLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHA 181
            L+   +LL    F +  G A L +  +YP  KR    PQ VLGI F+ G  +GW ++  
Sbjct: 132 CLVGLAVLLSLPRFAVITGIASLGVVAIYPLMKRITSVPQAVLGIAFSWGALMGWASVFR 191

Query: 182 SFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFV 241
           S   PA  L  G++ WV  +DT+YAHQD++DD ++GV STA LF   + + L + Y   V
Sbjct: 192 SIDDPALLLFAGSVCWVFAYDTIYAHQDREDDAIVGVRSTALLFGQSSWVALALSYTATV 251

Query: 242 LCFMVAFCLLTVNFFAWIGLL---IALFLTIKRIIALDISCSKQCCSFFHSAGVVGILIL 298
           + F +A       FFAW GL+     LF  ++R   LDI     C + F S    G+L  
Sbjct: 252 IFFALALMETPSGFFAWAGLVAFAAHLFNQVRR---LDIDDPDLCLALFKSNRDAGLLFF 308

Query: 299 ICLIISL 305
           + L + +
Sbjct: 309 VGLSLDV 315


>gi|291236028|ref|XP_002737946.1| PREDICTED: para-hydroxybenzoate-polyprenyltransferase,
           mitochondrial-like [Saccoglossus kowalevskii]
          Length = 394

 Score =  186 bits (471), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 116/291 (39%), Positives = 154/291 (52%), Gaps = 13/291 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S I PY+ L R     G  L  LPC WS  LAA P       G    F+ L ++ +GA V
Sbjct: 92  STIQPYLKLMRADKPIGTWLLYLPCTWSISLAAQP-------GSLPDFYTLALFGLGAWV 144

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT ND+ D D D  V RT+ RP+ +G  + +QAL F  LQ  +   +LLQ N + 
Sbjct: 145 MRGAGCTINDMWDRDFDKAVTRTQDRPIAAGDVSMYQALAFLALQLSVGLSILLQLNNYS 204

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTI 195
           I +G + L +   YP  KR    PQ  LG+ F  G  +GW A+  S  W     L I  I
Sbjct: 205 IVLGASSLVLVASYPLMKRVTFWPQAFLGLTFNWGALLGWAAIRGSCDWSVVLPLYISCI 264

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLL--TV 253
            W +++DTVYAHQDK DD LIGV STA LF  +TK WL     +FV    V   +   T+
Sbjct: 265 AWTLFYDTVYAHQDKDDDVLIGVKSTALLFGEKTKPWLAGFASVFVGGLTVTGIMTEQTL 324

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            ++A +GL +A   T  +I  LDI+    C   F S   +G LI++C I++
Sbjct: 325 PYYAAVGLTMAHLGT--QIATLDINNGDDCWKKFQSNKRLG-LIILCGIVA 372


>gi|126727782|ref|ZP_01743612.1| 4-hydroxybenzoate polyprenyl transferase [Rhodobacterales bacterium
           HTCC2150]
 gi|126702909|gb|EBA02012.1| 4-hydroxybenzoate polyprenyl transferase [Rhodobacterales bacterium
           HTCC2150]
          Length = 320

 Score =  185 bits (470), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 156/294 (53%), Gaps = 11/294 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTI-FWYLFIYIVGAIVTRG 79
           PY+ L+R     G  L +LPC W  +LAA     A   G   +  W +    +GA + RG
Sbjct: 31  PYLRLSRADRPIGTWLLLLPCWWGVLLAAL----ADPNGAKPLDLWIILACAMGAFLMRG 86

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICV 139
           A CTWND+ D   D++V RTRSRP+PSGQ    QA+++  LQ LIS  +LL   PF I +
Sbjct: 87  AGCTWNDITDRHYDAEVERTRSRPIPSGQVNLRQAVLWMALQALISLSILLTLAPFAIFL 146

Query: 140 GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVV 199
           GF  +    +YP++KRF   PQV LG+ F  G  + W A H S SW    L I  I W +
Sbjct: 147 GFLAILPVAVYPYAKRFTWWPQVFLGLAFNWGALLAWSAHHGSLSWAPIVLYIAGISWTL 206

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN----- 254
           ++DT+YAHQD +DD LIGV STARLF   +  WL +     V+    A  L T N     
Sbjct: 207 FYDTIYAHQDTEDDALIGVKSTARLFGENSPKWLNLFLTTTVILLGFAILLATQNASLPT 266

Query: 255 -FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
              A I      +  +  +  LDIS  + C S F +    G+++ + L +SL +
Sbjct: 267 TLIALIAPWAMGWHMMSLMKRLDISDPESCLSIFRAGRNTGLIVTLFLAVSLLV 320


>gi|86139069|ref|ZP_01057640.1| 4-hydroxybenzoate polyprenyl transferase [Roseobacter sp. MED193]
 gi|85824300|gb|EAQ44504.1| 4-hydroxybenzoate polyprenyl transferase [Roseobacter sp. MED193]
          Length = 320

 Score =  185 bits (470), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 117/296 (39%), Positives = 159/296 (53%), Gaps = 15/296 (5%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R     G  L ++PC W   LA   +   G   W    W      +GA + RGA
Sbjct: 31  PYLRLSRADRPIGTWLLLIPCWWGLALA---ILWDGSPRWEDA-WIAIACALGAWLMRGA 86

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D + D  V RTRSRP+PSGQ T   A+++ VLQ LISF +LL FNP  I +G
Sbjct: 87  GCTWNDITDRNFDGAVERTRSRPIPSGQVTVKGAVIWMVLQALISFGILLTFNPMAISMG 146

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              LF   +YPF+KRF   PQV LG+ F  G    W A   +  WPA  L    I W ++
Sbjct: 147 ILALFPVAIYPFAKRFTWWPQVFLGLAFNWGALWAWTAHSGALHWPAVALYFAGISWTLF 206

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCL-LTVNFFA 257
           +DT+YAHQD +DD LIGV STARLF   T  WL  FI+  + ++ F +   L L  N++A
Sbjct: 207 YDTIYAHQDTEDDALIGVKSTARLFGSNTPTWLRRFIVGTVSLMAFAIILALDLEDNYWA 266

Query: 258 WIGL------LIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
            +GL       +   +T +  I  D   +++    F      G++ LI  I++ FL
Sbjct: 267 -LGLALLGPWAMGWHMTWQLRI-FDAENNQRLLQLFRLNRDTGLIPLIFFILACFL 320


>gi|149913422|ref|ZP_01901955.1| 4-hydroxybenzoate polyprenyl transferase [Roseobacter sp. AzwK-3b]
 gi|149812542|gb|EDM72371.1| 4-hydroxybenzoate polyprenyl transferase [Roseobacter sp. AzwK-3b]
          Length = 321

 Score =  185 bits (469), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 118/307 (38%), Positives = 160/307 (52%), Gaps = 13/307 (4%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
            WV D    +A  PY+ LAR     G  L +LPC W  +LA   +   G   W  + W  
Sbjct: 21  NWV-DRFAPAATRPYLRLARADRPIGTWLLLLPCWWGLLLA---MLHDGRAHWHDL-WIF 75

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
               +GA + RGA CTWND+ D DID  V RT SRP+PSGQ +   ALV+ V Q L++F 
Sbjct: 76  AGCGIGAWLMRGAGCTWNDITDRDIDGSVARTASRPIPSGQVSVTGALVWLVAQALVAFC 135

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           +LL FN   I +G   L    +YPF+KRF   PQV LG+ F  G  + W A      WPA
Sbjct: 136 ILLTFNAAAIALGVLALLPVAIYPFAKRFTWWPQVFLGLAFNWGALLAWTAHAGQLEWPA 195

Query: 188 FFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA 247
             L +  I W +++DT+YAHQDK+DD LIGV STARLF  +T  WL I   + V    +A
Sbjct: 196 VLLYLAGISWTLFYDTIYAHQDKEDDALIGVKSTARLFGDRTPRWLAIFLVLTVALQSLA 255

Query: 248 FCLLTVNFFAWIGLLIALFLTIK-------RIIALDISCSKQCCSFFHSAGVVGILILIC 300
             +  +   +   LL+AL            ++  LD++ +++    F S    G+L L  
Sbjct: 256 VIIAAIGGSS-PALLVALLGPWAMGWHMQWQLRKLDLNDNERLLGLFRSNRDAGLLPLPF 314

Query: 301 LIISLFL 307
              +L L
Sbjct: 315 FAFALLL 321


>gi|84499776|ref|ZP_00998064.1| 4-hydroxybenzoate polyprenyl transferase [Oceanicola batsensis
           HTCC2597]
 gi|84392920|gb|EAQ05131.1| 4-hydroxybenzoate polyprenyl transferase [Oceanicola batsensis
           HTCC2597]
          Length = 320

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 127/213 (59%), Gaps = 4/213 (1%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R     G  L +LPC W   LA     RAG+    +  W      +GA + RGA
Sbjct: 31  PYLRLSRADRPIGTWLLLLPCWWGLALAMLHDGRAGL----SDLWIGIGCGLGAWLMRGA 86

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D  ID+ V RTRSRP+PSGQ T  QA V+  +Q L++F +LL F+P  I +G
Sbjct: 87  GCTWNDITDRRIDAGVARTRSRPIPSGQVTARQAAVWMAIQSLVAFAILLTFHPNAILLG 146

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L    +YPF+KRF   PQV LG+ F  G  + W A   S  WP   L +  I W ++
Sbjct: 147 ILSLGPVAIYPFAKRFTWWPQVFLGLAFNWGALLAWTAHTGSLGWPPVVLYLAGIAWTLF 206

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
           +DT+YAHQDK+DD LIGV STARLF  +T +WL
Sbjct: 207 YDTIYAHQDKEDDALIGVKSTARLFEDRTPVWL 239


>gi|126730425|ref|ZP_01746236.1| 4-hydroxybenzoate polyprenyl transferase [Sagittula stellata E-37]
 gi|126709158|gb|EBA08213.1| 4-hydroxybenzoate polyprenyl transferase [Sagittula stellata E-37]
          Length = 327

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 136/239 (56%), Gaps = 13/239 (5%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWY-LFIYI---VGAIV 76
           PY+ L+R     G  L +LPC W   LA     RA         W+ L+I++   VGAI+
Sbjct: 38  PYLRLSRADRPIGTWLLLLPCWWGLTLAMVSDGRAS--------WFDLWIFVGCGVGAIL 89

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CTWND+ D  ID  V RT SRP+PSGQ T  QAL +AV Q LI+ ++LL F P  
Sbjct: 90  MRGAGCTWNDITDRHIDGSVARTASRPIPSGQVTAKQALAWAVAQSLIALLILLTFPPMA 149

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I +G   L    +YPF+KRF   PQ+ LGI F  G  + W A   +  WPA FL +  + 
Sbjct: 150 IALGVLSLAPVAVYPFAKRFTWWPQIFLGIAFNWGALLAWTAHTGTLQWPAVFLYVAGMA 209

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQ-TKLWLFILYGIFVLCFMVAFCLLTVN 254
           W +++DT+YAHQDK+DD LIGV STARLF  + T  WL     + V    VA  L   +
Sbjct: 210 WTLFYDTIYAHQDKEDDALIGVKSTARLFGDEATPRWLAWFLALTVALQGVAIVLAAPD 268


>gi|89056404|ref|YP_511855.1| 4-hydroxybenzoate polyprenyltransferase [Jannaschia sp. CCS1]
 gi|88865953|gb|ABD56830.1| 4-hydroxybenzoate octaprenyltransferase [Jannaschia sp. CCS1]
          Length = 318

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 116/299 (38%), Positives = 161/299 (53%), Gaps = 17/299 (5%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIF--W 65
            WV D +   A  PY+ L+R     G  L +LPC W  +LA      A     +T+F  W
Sbjct: 16  NWV-DTLAPEATRPYLRLSRADRPIGTWLLLLPCWWGLMLAI-----ASTPATATLFDAW 69

Query: 66  YLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLIS 125
                 +GA + RGA CTWND+ D D+D  V RT SRP+PSGQ +   A+++ V Q LIS
Sbjct: 70  IFVGCAIGAFLMRGAGCTWNDITDRDLDGAVTRTASRPIPSGQVSVQGAIIWMVAQALIS 129

Query: 126 FVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW 185
            ++LL FN   I +G A   +  +YPF+KRF   PQV LG+ F  G  + W A   S S 
Sbjct: 130 LLILLTFNWTAIALGVASCALVCIYPFAKRFTWWPQVFLGLAFNWGALLAWTAHTGSLSL 189

Query: 186 PAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFM 245
               L +G I W +++DT+YAHQD++DD +IG+ STARLF   T++WL     I  LC M
Sbjct: 190 APVLLYLGGISWTLFYDTIYAHQDREDDAMIGIKSTARLFGENTRVWLRGFL-ILTLCLM 248

Query: 246 ---VAFCLL-TVNFFAWIGLLIALFLT----IKRIIALDISCSKQCCSFFHSAGVVGIL 296
              VA  L+ T NF A +  ++ ++        +++ LDI     C   F S    G+L
Sbjct: 249 GAGVAVALVPTGNFLALVVAILGVWAMGWHLTWQLMQLDIDDGDACLRLFRSNRNAGLL 307


>gi|312114483|ref|YP_004012079.1| 4-hydroxybenzoate polyprenyl transferase [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311219612|gb|ADP70980.1| 4-hydroxybenzoate polyprenyl transferase [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 331

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 104/298 (34%), Positives = 158/298 (53%), Gaps = 7/298 (2%)

Query: 12  DCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRR----AGVLGWSTIFWYL 67
           D +   ++ P++ L R     G  L + PC WS  LAA  L      A  L +    W L
Sbjct: 32  DRLAPESLKPWLRLMRADRPIGVWLLLWPCWWSVALAARYLNDFPNFASTLPY---LWLL 88

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
            ++ +G+ V R A C +ND++D DID++V RT+SRPL SG+ +   A    +   L+   
Sbjct: 89  VLFAIGSFVMRSAGCVYNDILDRDIDAKVARTQSRPLASGRISVKAAFALILALCLVGLA 148

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           +L+QFN F I +GFA + I L+YP  KR    PQ VLG+ F+ G  +GW A+  S     
Sbjct: 149 VLIQFNVFAIALGFASVGIVLIYPLMKRVTFWPQAVLGLAFSWGALMGWAAIFGSLGVAP 208

Query: 188 FFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA 247
             L    + W + +DT+YAHQDK+DD +IG+ STA  F   T  WL + YGI ++   +A
Sbjct: 209 ILLYAAAVAWTIGYDTIYAHQDKEDDAVIGLKSTALRFGKNTPAWLALFYGITIVGITLA 268

Query: 248 FCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
             L+   +  + G+ +A    I +I  LD+   + C   F S  + G ++   LI+ +
Sbjct: 269 GVLVGAGYVFYGGMALAAGHLIWQITTLDMDNGQNCLDRFRSNHLFGAIVFFALILDM 326


>gi|126463428|ref|YP_001044542.1| 4-hydroxybenzoate polyprenyltransferase [Rhodobacter sphaeroides
           ATCC 17029]
 gi|126105092|gb|ABN77770.1| 4-hydroxybenzoate octaprenyltransferase [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 333

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 113/298 (37%), Positives = 156/298 (52%), Gaps = 15/298 (5%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTI-FWY 66
            WV D +  +A  PY+ L+R     G  L ++PC W+  LAA     A   G+  +  W 
Sbjct: 31  NWV-DRLAPAATRPYLRLSRADRPIGTWLLLIPCFWAVALAAL----ADPEGYRPLDLWL 85

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           +    VGA + RGA CTWND+ D + D+ V RTRSRP+PSGQ +   A V+ V+Q L++ 
Sbjct: 86  VIGSTVGAFLMRGAGCTWNDITDREFDAAVARTRSRPIPSGQVSAKAAAVWMVVQALVAS 145

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           ++L  FN   I +G A L +  +YPF+KRF   PQ  LG+ F  G  + W A   S  W 
Sbjct: 146 LILFSFNGTAILLGVASLALVCIYPFAKRFTWWPQAFLGLAFNWGALLLWAAHTGSLGWA 205

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV 246
              L    I W +++DT+YAHQDK+DD LIGV STARLF   T  WL        L   +
Sbjct: 206 PVALYASGIAWTLFYDTIYAHQDKEDDALIGVRSTARLFGQHTGKWLVAFMMAATLLMTL 265

Query: 247 AFCLLTVNFFAWIGLLIAL--------FLTIKRIIALDISCSKQCCSFFHSAGVVGIL 296
           A  L  +   + + LLIAL         +T + I  LD   + +C   F S    G++
Sbjct: 266 AVLLAVLPQGSILQLLIALAGVWGFGAHMTWQ-IARLDTEDTARCLRLFRSNRDAGLI 322


>gi|126740600|ref|ZP_01756287.1| 4-hydroxybenzoate polyprenyl transferase [Roseobacter sp.
           SK209-2-6]
 gi|126718401|gb|EBA15116.1| 4-hydroxybenzoate polyprenyl transferase [Roseobacter sp.
           SK209-2-6]
          Length = 320

 Score =  182 bits (462), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 135/245 (55%), Gaps = 7/245 (2%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
            WV D I      PY+ L+R     G  L ++PC W   LA   +   G  GW    W  
Sbjct: 19  NWV-DEIAPEWSRPYLRLSRADRPIGTWLLLIPCWWGLALA---ILWDGQWGWHDA-WIA 73

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
               +GA + RGA CTWND+ D   D  V RTRSRP+PSGQ T   A+++ VLQ LISF 
Sbjct: 74  IASGLGAWLMRGAGCTWNDITDRKFDGAVERTRSRPIPSGQVTVRGAVIWMVLQALISFG 133

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           +LL FN   I +G   L    +YPF+KRF   PQV LG+ F  G    W A   +  WPA
Sbjct: 134 ILLTFNRMAISMGILALLPVAIYPFAKRFTWWPQVFLGLAFNWGALWAWTAHTGALHWPA 193

Query: 188 FFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFM 245
            FL +  I W +++DT+YAHQD +DD LIGV STARLF   T  WL  FI+  + ++ F 
Sbjct: 194 VFLYLAGISWTLFYDTIYAHQDTEDDALIGVKSTARLFGDNTPAWLRRFIVGTVSLMAFA 253

Query: 246 VAFCL 250
           V   +
Sbjct: 254 VILAM 258


>gi|221640499|ref|YP_002526761.1| 4-hydroxybenzoate polyprenyltransferase [Rhodobacter sphaeroides
           KD131]
 gi|221161280|gb|ACM02260.1| 4-hydroxybenzoate octaprenyltransferase [Rhodobacter sphaeroides
           KD131]
          Length = 310

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 114/305 (37%), Positives = 158/305 (51%), Gaps = 15/305 (4%)

Query: 1   MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGW 60
           M+      WV D +  +A  PY+ L+R     G  L ++PC W+  LAA     A   G+
Sbjct: 1   MADAPPGNWV-DRLAPAATRPYLRLSRADRPIGTWLLLIPCFWAVALAAL----ADPGGY 55

Query: 61  STI-FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAV 119
             +  W +    VGA + RGA CTWND+ D + D+ V RTRSRP+PSGQ +   A V+ V
Sbjct: 56  RPLDLWLVIGSSVGAFLMRGAGCTWNDITDREFDAAVARTRSRPIPSGQVSAKAAAVWMV 115

Query: 120 LQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL 179
           +Q L++ ++L  FN   I +G A L +  +YPF+KRF   PQ  LG+ F  G  + W A 
Sbjct: 116 VQALVASLILFSFNGTAILLGVASLALVCIYPFAKRFTWWPQAFLGLAFNWGALLLWAAH 175

Query: 180 HASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGI 239
             S  W    L    I W +++DT+YAHQDK+DD LIGV STARLF   T  WL      
Sbjct: 176 TGSLGWAPVALYASGIAWTLFYDTIYAHQDKEDDALIGVRSTARLFGQHTGKWLVAFMMA 235

Query: 240 FVLCFMVAFCLLTVNFFAWIGLLIAL--------FLTIKRIIALDISCSKQCCSFFHSAG 291
             L   +A  L  +   + + LLIAL         +T + I  LD   + +C   F S  
Sbjct: 236 ATLLMTLAVLLAVLPQGSILQLLIALAGVWGFGAHMTWQ-IARLDTEDTARCLRLFRSNR 294

Query: 292 VVGIL 296
             G++
Sbjct: 295 DAGLI 299


>gi|254463328|ref|ZP_05076744.1| 4-hydroxybenzoate polyprenyl transferase [Rhodobacterales bacterium
           HTCC2083]
 gi|206679917|gb|EDZ44404.1| 4-hydroxybenzoate polyprenyl transferase [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 321

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 103/241 (42%), Positives = 137/241 (56%), Gaps = 7/241 (2%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
            WV D      + PY+ L+R+    G  L +LPC W+ +LA   +  +G   W    W  
Sbjct: 21  NWV-DTTAPDWLRPYLRLSRFDRPIGTWLLLLPCWWALMLA---MLWSGNADWFDA-WIF 75

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
               +GA + RGA CTWND+ D D D  V RTR+RP+PSGQ T  QA+++  LQ +IS  
Sbjct: 76  IGCAIGATLMRGAGCTWNDITDRDYDGAVERTRNRPIPSGQVTVRQAVIWMALQTVISLG 135

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           +LL FN   I +G   L   L+YPF+KRF   PQV LG+ F  G  + W A   S  WPA
Sbjct: 136 VLLTFNWAAISLGVLSLLPVLVYPFAKRFTWWPQVFLGLAFNWGALLAWTAHSGSLGWPA 195

Query: 188 FFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFM 245
             L    I W +++DT+YAHQD +DD LIG+ STARLF   T  WL  F++  + + CF 
Sbjct: 196 VTLYAAGIAWTLFYDTIYAHQDTEDDALIGIKSTARLFGDATPQWLLYFLIASLTLFCFA 255

Query: 246 V 246
           V
Sbjct: 256 V 256


>gi|254509796|ref|ZP_05121863.1| 4-hydroxybenzoate polyprenyl transferase [Rhodobacteraceae
           bacterium KLH11]
 gi|221533507|gb|EEE36495.1| 4-hydroxybenzoate polyprenyl transferase [Rhodobacteraceae
           bacterium KLH11]
          Length = 320

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 160/297 (53%), Gaps = 17/297 (5%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R     G  L ++PC W  VLA   +   G   W  + W      +GA + RGA
Sbjct: 31  PYLRLSRADRPIGTWLLLIPCWWGLVLA---ILSDGTPRWGDL-WIAAGCAIGAFLMRGA 86

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D + D +V RTRSRP+PSGQ +  QA+++  LQ L++ V+LL FN   I +G
Sbjct: 87  GCTWNDITDREFDGKVERTRSRPIPSGQVSVRQAVIWMGLQCLLALVILLTFNRAAIAMG 146

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L    +YPF+KRF   PQV LG+ F  G  + W A   +  WPA  L +  I W ++
Sbjct: 147 VLSLLPVTIYPFAKRFTWWPQVFLGLAFNWGALLAWAAHTGTIGWPAIMLYLSGIAWTLF 206

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL-FILYGIFVLCFM--VAFCLLTVNFFA 257
           +DT+YAHQD +DDELIG+ STARLF   T  WL + L G   L  +  +     +V+  A
Sbjct: 207 YDTIYAHQDAEDDELIGIKSTARLFGTDTARWLKYFLVGTVSLMGLAIIDAAQASVSVLA 266

Query: 258 WIGLLIAL-------FLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
              L++AL       +    ++  LD   + +    F +    G++ LI L ++L L
Sbjct: 267 ---LVVALGGPWAMGWHMAWQLRGLDTEDNAKLLQLFRANRDTGLIPLIFLCVALVL 320


>gi|23014901|ref|ZP_00054696.1| COG0382: 4-hydroxybenzoate polyprenyltransferase and related
           prenyltransferases [Magnetospirillum magnetotacticum
           MS-1]
          Length = 304

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 108/291 (37%), Positives = 148/291 (50%), Gaps = 9/291 (3%)

Query: 12  DCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYI 71
           D  + +A+ PY  L R     G  L + PC WS  LA+          W  + W + ++ 
Sbjct: 18  DRYVPAALRPYFRLMRLDRPIGTWLLLFPCWWSIALASE--------RWPDL-WLMALFA 68

Query: 72  VGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQ 131
           VGA+V RGA CT+ND  D + D +V RT SRP+PSG  +  QAL F  LQ L   V+L+Q
Sbjct: 69  VGAVVMRGAGCTFNDWADREFDGRVARTASRPIPSGAVSPNQALAFLGLQLLTGLVILMQ 128

Query: 132 FNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLC 191
            N F I VG A L +   YPF KR    PQ  LG+ F  G  +GW A+      PA  L 
Sbjct: 129 LNDFAIAVGIASLLLVFPYPFMKRITYWPQAWLGLTFNWGALLGWAAVSGHMGLPALLLY 188

Query: 192 IGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLL 251
               FW + +DT+YAHQDK+DD +IGV STA      T  WL++ Y   ++    A    
Sbjct: 189 AAGPFWTLGYDTIYAHQDKEDDAMIGVKSTALRLGDATVKWLWLFYPATLVLIGAAGWAA 248

Query: 252 TVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
            + +  W GL +A    + +I  +DI+    C   F S    G L+L  ++
Sbjct: 249 GLGWAFWPGLALAGGHLLWQIRNVDINDGADCLDKFKSNRHFGWLVLAAIM 299


>gi|77464588|ref|YP_354092.1| 4-hydroxybenzoate polyprenyltransferase [Rhodobacter sphaeroides
           2.4.1]
 gi|77389006|gb|ABA80191.1| 4-hydroxybenzoate octaprenyltransferase [Rhodobacter sphaeroides
           2.4.1]
          Length = 333

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 113/298 (37%), Positives = 156/298 (52%), Gaps = 15/298 (5%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTI-FWY 66
            WV D +  +A  PY+ L+R     G  L ++PC W+  LAA     A   G+  +  W 
Sbjct: 31  NWV-DRLAPAATRPYLRLSRADRPIGTWLLLIPCFWAVALAAL----ADPGGYRPLDLWL 85

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           +    VGA + RGA CTWND+ D + D+ V RTRSRP+PSGQ +   A V+ V+Q L++ 
Sbjct: 86  VIGSSVGAFLMRGAGCTWNDITDREFDAAVARTRSRPIPSGQVSAKAAAVWMVVQALVAS 145

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           ++L  FN   I +G A L +  +YPF+KRF   PQ  LG+ F  G  + W A   S  W 
Sbjct: 146 LILFSFNGTAILLGVASLALVCIYPFAKRFTWWPQAFLGLAFNWGALLLWAAHTGSLGWA 205

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV 246
              L    I W +++DT+YAHQDK+DD LIGV STARLF   T  WL        L   +
Sbjct: 206 PVALYASGIAWTLFYDTIYAHQDKEDDALIGVRSTARLFGQHTGKWLVAFMMAATLLMTL 265

Query: 247 AFCLLTVNFFAWIGLLIAL--------FLTIKRIIALDISCSKQCCSFFHSAGVVGIL 296
           A  L  +   + + LLIAL         +T + I  LD   + +C   F S    G++
Sbjct: 266 AVLLTVLPQGSILQLLIALAGVWGFGAHMTWQ-IARLDTEDTARCLRLFRSNRDAGLI 322


>gi|259415163|ref|ZP_05739085.1| 4-hydroxybenzoate polyprenyl transferase [Silicibacter sp.
           TrichCH4B]
 gi|259349073|gb|EEW60827.1| 4-hydroxybenzoate polyprenyl transferase [Silicibacter sp.
           TrichCH4B]
          Length = 320

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 116/297 (39%), Positives = 155/297 (52%), Gaps = 19/297 (6%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R     G  L +LPC W   LA    + A    W  + W      +GA + RGA
Sbjct: 31  PYLRLSRADRPIGTWLLLLPCWWGLALAMIAGQNAR---WEDL-WIFVACGLGAWLMRGA 86

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D DID  V RTRSRP+PSGQ T   AL +  LQ LI+F +LL FN   + +G
Sbjct: 87  GCTWNDITDRDIDGGVERTRSRPIPSGQVTVRGALAWMALQSLIAFGILLTFNQAAVAMG 146

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              LF   +YPF+KRF   PQV LG+ F  G  + W A      WPA  L    + W ++
Sbjct: 147 ILALFPVAIYPFAKRFTWWPQVFLGLAFNWGAMLAWVAHSGRLDWPAVVLYAAGMAWTLF 206

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVNFFAW 258
           +DT+YAHQD +DD LIGV STARLF  +T  WL  FI   +  +  M    ++ V   A 
Sbjct: 207 YDTIYAHQDTEDDALIGVKSTARLFGTETPTWLRRFI---VATVSLMALSIIMAVQPTAS 263

Query: 259 IGLLIALFLTIK---------RIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
           + L +AL L            ++ A D   + +  S F      G++ LI L ++LF
Sbjct: 264 V-LALALSLCAPWAMGWHMTWQLRAFDADNNDRLLSLFRLNRDTGLIPLIFLGLALF 319


>gi|260431630|ref|ZP_05785601.1| 4-hydroxybenzoate polyprenyl transferase [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260415458|gb|EEX08717.1| 4-hydroxybenzoate polyprenyl transferase [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 320

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 105/294 (35%), Positives = 153/294 (52%), Gaps = 11/294 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R     G  L ++PC W   LA   +   G   W  + W       GA + RGA
Sbjct: 31  PYLRLSRADRPIGTWLLLIPCWWGLALA---ILHDGQPRWGDL-WIAVGCAAGAFLMRGA 86

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D   D+QV RTRSRP+PSGQ +  QA+++  +Q L++  +LL FN   I +G
Sbjct: 87  GCTWNDITDRKFDAQVARTRSRPIPSGQVSVRQAVIWMGIQCLLALAILLTFNQAAIAMG 146

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L    +YP++KRF   PQV LG+ F  G  + W A   +  WPA  L +  I W ++
Sbjct: 147 VLSLLPVTIYPYAKRFTWWPQVFLGLAFNWGALLAWAAHRGTVEWPAILLYLSGIAWTLF 206

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQD +DDELIG+ STARLF   T  WL       V    +A     +   + + 
Sbjct: 207 YDTIYAHQDAEDDELIGIKSTARLFGTDTAKWLKYFLVATVALMGLAIIEAALPNASVLA 266

Query: 261 LLIAL-------FLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
           L +A+       +    ++  LDI  + +    F +    G++ LI L ++L L
Sbjct: 267 LAVAIGGPWAMGWHMAWQLRGLDIEDNAKLLQLFRANRDTGLIPLIFLCVALLL 320


>gi|209966871|ref|YP_002299786.1| 4-hydroxybenzoate polyprenyl transferase [Rhodospirillum centenum
           SW]
 gi|209960337|gb|ACJ00974.1| 4-hydroxybenzoate polyprenyl transferase [Rhodospirillum centenum
           SW]
          Length = 353

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 110/299 (36%), Positives = 158/299 (52%), Gaps = 10/299 (3%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
            WV D  + +A  PY  LAR     G  L + P  W+  +AA P       G     W +
Sbjct: 25  SWV-DRWLPAAWRPYARLARLDRPIGTWLLLFPGWWAIAMAAPP-------GHWPDLWLM 76

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
            ++ +GA+V RGA CT NDL+D D+D++V RTR RP+PSG  T  QA  F V Q L+ F+
Sbjct: 77  ALFAIGAVVMRGAGCTVNDLLDRDLDARVERTRVRPIPSGDVTATQAAGFLVFQLLLGFL 136

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           +L+Q N   I +G A L +   YP  KR    PQ  LG+ F  G  +GW A+  S  WP+
Sbjct: 137 VLIQLNWLSIWLGVASLALVGTYPLMKRITWWPQAFLGLTFNWGAIMGWTAVRGSLDWPS 196

Query: 188 FFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFMV 246
             L  G I W + +DT+YAHQDK+DD  +G+ STARLF   +K ++ + Y G FVL +  
Sbjct: 197 LVLYAGCILWTLGYDTIYAHQDKEDDARVGIKSTARLFGAASKRYVGLFYAGAFVL-WCA 255

Query: 247 AFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
           A   L       + LL    L + ++ + D        + F ++  VG  +LI ++  +
Sbjct: 256 ALLPLGHGAAMTVPLLATAALLVVQVRSWDPDDPADSLAAFKASRFVGWALLIGIVAGI 314


>gi|99078058|ref|YP_611316.1| 4-hydroxybenzoate polyprenyltransferase [Ruegeria sp. TM1040]
 gi|99035196|gb|ABF62054.1| 4-hydroxybenzoate octaprenyltransferase [Ruegeria sp. TM1040]
          Length = 320

 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 113/297 (38%), Positives = 158/297 (53%), Gaps = 19/297 (6%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R     G  L +LPC W   LA    + A    W  + W      +GA + RGA
Sbjct: 31  PYLRLSRADRPIGTWLLLLPCWWGLALAMIAGQDAR---WEDL-WIFVACALGAWLMRGA 86

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D +ID  V RTRSRP+PSGQ +   AL +  LQ LI+F +LL FN   + +G
Sbjct: 87  GCTWNDITDRNIDGSVERTRSRPIPSGQVSIKGALAWMALQSLIAFGILLTFNQAAVAMG 146

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              LF   +YPF+KRF   PQ+ LG+ F  G  + W A     +WPA  L +  I W ++
Sbjct: 147 ILALFPVAIYPFAKRFTWWPQIFLGLAFNWGAMLAWVAHTGHLNWPAVVLYVAGIAWTLF 206

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVNFFAW 258
           +DT+YAHQD +DD LIGV STARLF   T  WL  FI+  + ++   +   ++ V   A 
Sbjct: 207 YDTIYAHQDAEDDALIGVKSTARLFGTNTPTWLRRFIVATVSLMALAI---IMAVQPAAS 263

Query: 259 IGLLIALFLTIK---------RIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
           + L +AL L            ++ A D   + +  S F      G++ LI L ++LF
Sbjct: 264 V-LALALSLCAPWAMGWHMTWQLRAFDADNNDRLLSLFRLNRDTGLIPLIFLGLALF 319


>gi|254464573|ref|ZP_05077984.1| 4-hydroxybenzoate polyprenyl transferase [Rhodobacterales bacterium
           Y4I]
 gi|206685481|gb|EDZ45963.1| 4-hydroxybenzoate polyprenyl transferase [Rhodobacterales bacterium
           Y4I]
          Length = 320

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 108/294 (36%), Positives = 154/294 (52%), Gaps = 11/294 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R     G  L ++PC W   LA    +      W  + W +     GA + RGA
Sbjct: 31  PYLRLSRADRPIGTWLLLIPCWWGLALAILADQSPR---WQDL-WIVTGCAAGAWLMRGA 86

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D + D QV RTRSRP+PSGQ T   AL +  LQ L+  ++LL FN   I +G
Sbjct: 87  GCTWNDITDRNFDGQVERTRSRPIPSGQVTVKGALAWMALQCLLGLMILLTFNQAAIAMG 146

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L    +YPF+KRF   PQV LG+ F  G  + W A   S SWP   L +  I W ++
Sbjct: 147 ILSLLPVAVYPFAKRFTWWPQVFLGLAFNWGAMLAWVAHTGSLSWPPVLLYLAGIAWTLF 206

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQD +DD LIGV STARLF  QT +WL      FV    +A     ++  + + 
Sbjct: 207 YDTIYAHQDTEDDALIGVKSTARLFGTQTPVWLRRFIMAFVSLMAMAVIGAMLDSASVLA 266

Query: 261 LLIAL-------FLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
           L++AL       +    ++ A D   +++    F      G++ LI   +++F+
Sbjct: 267 LVLALAGPWAMGWHMTWQLRAFDAENNQRLLQLFRLNRDTGLIPLIFFALAMFV 320


>gi|224049264|ref|XP_002191010.1| PREDICTED: similar to para-hydroxybenzoate-polyprenyltransferase,
           mitochondrial [Taeniopygia guttata]
          Length = 347

 Score =  178 bits (452), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 155/294 (52%), Gaps = 18/294 (6%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           +A+ PY+ L R H   G  L  LPC WS  LAA P   A    W      L +++VGA++
Sbjct: 62  AALQPYLRLMRLHQPAGTWLLYLPCTWSIGLAADP---AVFPNWCM----LSLFVVGAVL 114

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT ND+ D D D QV RT SRPL +G  + FQ+LVF   Q  ++  +LL  N + 
Sbjct: 115 MRGAGCTINDMWDRDYDRQVARTASRPLAAGDISTFQSLVFLGGQLSLALCVLLCLNYYS 174

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW----PAFFLCI 192
           I +G A L + + YP  KR    PQ+VLG  F  G  +GW A+  S  W    P +F   
Sbjct: 175 IILGAASLLLVITYPLMKRVTYWPQLVLGFTFNWGALLGWSAIKGSCEWSVCLPLYF--- 231

Query: 193 GTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCL 250
             + W + +DT+YAHQDK+DD +IGV STA  F   TK WL  F L  +  LC     C 
Sbjct: 232 AGVMWTLVYDTIYAHQDKRDDIMIGVKSTALQFKEDTKQWLSGFSLAMLLSLCMAGMNCN 291

Query: 251 LTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            T  +++ +  + A      +I  LDI   + C   F S   VGI++ I +++ 
Sbjct: 292 QTFPYYSAVAAVGAHL--AHQIYTLDIDKPEDCWKKFASNRTVGIMLFIGIVLG 343


>gi|56698450|ref|YP_168824.1| 4-hydroxybenzoate polyprenyltransferase [Ruegeria pomeroyi DSS-3]
 gi|56680187|gb|AAV96853.1| 4-hydroxybenzoate polyprenyl transferase [Ruegeria pomeroyi DSS-3]
          Length = 320

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 107/293 (36%), Positives = 151/293 (51%), Gaps = 11/293 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R     G  L ++PC W   LA    + A    W  + W      +GA + RGA
Sbjct: 31  PYLRLSRADRPIGTWLLLIPCWWGLALAMLDGQDAR---WGDL-WIALGCAIGAFLMRGA 86

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D + D +V RTRSRP+PSGQ +   A+V+ + Q L++ ++LL FN   I +G
Sbjct: 87  GCTWNDITDREFDGRVERTRSRPIPSGQVSVRMAVVWMIAQALLALMILLTFNRMAIAMG 146

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L    +YPF+KRF   PQV LG+ F  G  + W A   S  W A FL +  I W ++
Sbjct: 147 VLSLLPVAVYPFAKRFTWWPQVFLGLAFNWGALLAWTAHSGSLGWGALFLYLAGIAWTLF 206

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL-------FILYGIFVLCFMVAFCLLTV 253
           +DT+YAHQD +DD LIGV STARLF  QT  W+         L GI V    +    +  
Sbjct: 207 YDTIYAHQDTEDDALIGVKSTARLFGAQTPRWMSYFLVATVSLMGIAVFEAALPDASILA 266

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
              A  G     +    ++  LD+  + +    F      G++ LI  +I+LF
Sbjct: 267 LVLALAGPWAMGWHMAWQLRGLDLDDNGKLLQLFRVNRDTGLIPLIFFVIALF 319


>gi|254474399|ref|ZP_05087785.1| 4-hydroxybenzoate polyprenyl transferase [Ruegeria sp. R11]
 gi|214028642|gb|EEB69477.1| 4-hydroxybenzoate polyprenyl transferase [Ruegeria sp. R11]
          Length = 320

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 99/232 (42%), Positives = 136/232 (58%), Gaps = 14/232 (6%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWY-LFIYIV---GAIV 76
           PY+ L+R     G  L ++PC W   LA        +L   +  W  L+I++    G+ +
Sbjct: 31  PYLRLSRADRPIGTWLLLIPCWWGLALA--------ILWDQSPRWEDLWIFVACAAGSWL 82

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CTWND+ D + D QV RTRSRP+PSGQ T   A+++  LQ LISF +LL FN   
Sbjct: 83  MRGAGCTWNDITDRNFDGQVERTRSRPIPSGQVTVKGAVIWMGLQALISFAILLSFNQAT 142

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           + +G   LF   +YPF+KRF   PQV LG+ F  G  + W A   + +WPA  L +  I 
Sbjct: 143 VAMGILALFPVAIYPFAKRFTWWPQVFLGLAFNWGAMLAWVAHTGTLNWPAVVLYLAGIA 202

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMV 246
           W +++DT+YAHQD +DD LIGV STARLF   T +WL  FI+  + ++   V
Sbjct: 203 WTLFYDTIYAHQDTEDDALIGVKSTARLFGTDTPMWLRRFIVATVSLMALAV 254


>gi|114763455|ref|ZP_01442862.1| 4-hydroxybenzoate polyprenyl transferase [Pelagibaca bermudensis
           HTCC2601]
 gi|114543993|gb|EAU47004.1| 4-hydroxybenzoate polyprenyl transferase [Roseovarius sp. HTCC2601]
          Length = 343

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 96/214 (44%), Positives = 124/214 (57%), Gaps = 5/214 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R     G  L +LPC W  +L+     RA +       W      +GA + RGA
Sbjct: 54  PYLRLSRADRPIGTWLLLLPCWWGLLLSMVHDGRASLFD----LWIFAGCGIGAFLMRGA 109

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D  ID  V RT SRP+PSGQ +  QAL +AV+Q L+SF +L+ F P  I +G
Sbjct: 110 GCTWNDITDRKIDGSVARTASRPIPSGQVSTKQALAWAVIQSLVSFGILVTFPPMAIALG 169

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L    +YPF+KRF   PQ+ LGI F  G  + W A   S  WPA  L +  + W ++
Sbjct: 170 VLSLAPVAIYPFAKRFTWWPQIFLGIAFNWGALLAWTAHSGSLGWPAVLLYLAGMAWTLF 229

Query: 201 FDTVYAHQDKKDDELIGVNSTARLF-SYQTKLWL 233
           +DT+YAHQDK+DD LIGV STARLF    T  WL
Sbjct: 230 YDTIYAHQDKEDDALIGVKSTARLFGDAATPKWL 263


>gi|163738855|ref|ZP_02146268.1| 4-hydroxybenzoate polyprenyl transferase [Phaeobacter gallaeciensis
           BS107]
 gi|161387660|gb|EDQ12016.1| 4-hydroxybenzoate polyprenyl transferase [Phaeobacter gallaeciensis
           BS107]
          Length = 320

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 124/213 (58%), Gaps = 4/213 (1%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R     G  L ++PC W  +LA    +      W  + W       GA + RGA
Sbjct: 31  PYLRLSRADRPIGTWLLLIPCWWGLMLAILWDQSPR---WEDL-WIFAACAAGAWLMRGA 86

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D + D QV RTRSRP+PSGQ T   A ++  LQ LIS  +LL FN   I +G
Sbjct: 87  GCTWNDITDRNFDGQVERTRSRPIPSGQVTVTGAFIWMGLQALISLGILLSFNQAAIAMG 146

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              LF   +YPF+KRF   PQV LG+ F  G  + W A   + +WPA  L +  I W ++
Sbjct: 147 ILALFPVAIYPFAKRFTWWPQVFLGLAFNWGAMLAWVAHTGTLNWPAVILYLAGIAWTLF 206

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
           +DT+YAHQD +DD LIGV STARLF  QT +WL
Sbjct: 207 YDTIYAHQDTEDDALIGVKSTARLFGTQTPMWL 239


>gi|255261497|ref|ZP_05340839.1| 4-hydroxybenzoate polyprenyl transferase [Thalassiobium sp. R2A62]
 gi|255103832|gb|EET46506.1| 4-hydroxybenzoate polyprenyl transferase [Thalassiobium sp. R2A62]
          Length = 321

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 102/234 (43%), Positives = 127/234 (54%), Gaps = 4/234 (1%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R     G  L +LPC W  VLA     RA         W      +GA + RGA
Sbjct: 33  PYLRLSRADRPIGTWLLLLPCWWGLVLAMLASGRATWFD----LWIAVGCAIGAFLMRGA 88

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWNDL D DID+QV RT+SRPLPSG  +   A V+  LQ  +S  +LL FN   I +G
Sbjct: 89  GCTWNDLADRDIDAQVARTQSRPLPSGAVSTKGAFVWLGLQCAVSLGILLTFNWMAIGLG 148

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L    +YPF+KRF   PQV LG+ F  G  + W A   S  WPA  L +  I W ++
Sbjct: 149 VLSLIPVAIYPFAKRFTWWPQVFLGLAFNWGALLAWSAHSGSLGWPAVALYLAGIAWTLF 208

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
           +DT+YAHQD +DD LIGV STA+LF  +T  WL       V  F VA  + T  
Sbjct: 209 YDTIYAHQDTEDDALIGVKSTAQLFGERTPSWLRFFLMTTVTLFGVAALMATAE 262


>gi|260575963|ref|ZP_05843958.1| 4-hydroxybenzoate polyprenyl transferase [Rhodobacter sp. SW2]
 gi|259021889|gb|EEW25190.1| 4-hydroxybenzoate polyprenyl transferase [Rhodobacter sp. SW2]
          Length = 324

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 101/226 (44%), Positives = 130/226 (57%), Gaps = 6/226 (2%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
            WV D +  +A  PY+ L+R     G  L ++PCLW   LAA    R G   +    W +
Sbjct: 24  NWV-DTLAPAATRPYLRLSRADRPIGTWLLLIPCLWGVALAAA---RDGFRLFD--LWII 77

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
               +GA + RGA CTWND+ D + D+ V RTRSRP+PSGQ T  QALV+ V Q L   +
Sbjct: 78  LGCALGAFLMRGAGCTWNDITDREFDAAVTRTRSRPIPSGQVTVKQALVWMVGQSLAGAL 137

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           +L  FN   I +G   L +  +YPF+KRF   PQV LG+ F  G  + + A       PA
Sbjct: 138 ILFSFNWVAIGLGVGSLALVAVYPFAKRFTWWPQVFLGLAFNWGALLAYTAHAGRLEAPA 197

Query: 188 FFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
             L +G I W +++DT+YAHQDK DD LIGV STARLF   TK WL
Sbjct: 198 VLLWMGGITWTLFYDTIYAHQDKDDDALIGVKSTARLFGAATKPWL 243


>gi|297184219|gb|ADI20337.1| 4-hydroxybenzoate polyprenyltransferase and related
           prenyltransferases [uncultured alpha proteobacterium
           EB080_L27A02]
          Length = 252

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 103/242 (42%), Positives = 141/242 (58%), Gaps = 10/242 (4%)

Query: 72  VGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQ 131
           +GA + RGA CTWND+ D  ID++V RT+SRP+PSGQ T  QAL + ++Q L   ++L  
Sbjct: 3   IGAFLMRGAGCTWNDITDQKIDARVARTKSRPIPSGQITPKQALKWMLIQTLAGALVLFT 62

Query: 132 FNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLC 191
           FN F I +G   L    +YPF+KRF   PQ+ LG+ F  G  +GW A   S S     L 
Sbjct: 63  FNKFTIVLGIFALVPVTIYPFAKRFTWWPQLFLGVAFNWGALIGWSAQIGSLSLSPILLY 122

Query: 192 IGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVL--CFMVA 247
           +  I W +++DT+YAHQDK+DD LIGV STARLF   TK WL  F++  I ++   F+VA
Sbjct: 123 LAGISWTLFYDTIYAHQDKEDDALIGVRSTARLFHSNTKKWLWCFLILSISLMIGAFVVA 182

Query: 248 FCLLTVNFFAWIGLLIALFLTIK---RIIALDISCSKQCCSFFHS---AGVVGILILICL 301
              +   F+  IG+   L   I    ++  LDI+ +  C   F S   AG++ IL   C 
Sbjct: 183 LQNIVNVFYFMIGISGILAFGIHLIWQLKNLDINSADNCLMIFRSNRNAGLLPILGFTCA 242

Query: 302 II 303
           II
Sbjct: 243 II 244


>gi|146276273|ref|YP_001166432.1| 4-hydroxybenzoate polyprenyltransferase [Rhodobacter sphaeroides
           ATCC 17025]
 gi|145554514|gb|ABP69127.1| 4-hydroxybenzoate octaprenyltransferase [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 330

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 112/285 (39%), Positives = 156/285 (54%), Gaps = 14/285 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTI-FWYLFIYIVGAIVTRG 79
           PY+ L+R     G  L ++PCLW+  LAA     AG  G+  +  W +    VGA + RG
Sbjct: 40  PYLRLSRADRPIGTWLLLIPCLWAVALAAL----AGPEGYRPLDLWLVIGSAVGAFLMRG 95

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICV 139
           A CTWND+ D D D+ V RTRSRP+PSGQ +  +A+V+ V+Q L++ ++L  FN   I +
Sbjct: 96  AGCTWNDITDRDFDAAVARTRSRPIPSGQVSTKRAVVWMVVQALVASLILFSFNAAAILL 155

Query: 140 GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVV 199
           G A L +  +YPF+KRF   PQ  LG+ F  G  + W A   S  WP   L    I W +
Sbjct: 156 GIASLALVGIYPFAKRFTWWPQAFLGLAFNWGALLLWAAHTGSLGWPPVALYGAGIAWTL 215

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
           ++DT+YAHQDK+DD LIGV STARLF   T  WL     I  L   +A  L  +   + +
Sbjct: 216 FYDTIYAHQDKEDDALIGVRSTARLFGQNTGRWLVAFMVIATLLMTLAVLLAVLPQGSIL 275

Query: 260 GLLIAL--------FLTIKRIIALDISCSKQCCSFFHSAGVVGIL 296
            L+IAL         +T + +  LD   + +C   F S    G++
Sbjct: 276 QLMIALAGVWGFGAHMTWQ-LAQLDTEDTGRCLRLFRSNRDAGLI 319


>gi|163741897|ref|ZP_02149287.1| 4-hydroxybenzoate polyprenyl transferase [Phaeobacter gallaeciensis
           2.10]
 gi|161385070|gb|EDQ09449.1| 4-hydroxybenzoate polyprenyl transferase [Phaeobacter gallaeciensis
           2.10]
          Length = 320

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 123/215 (57%), Gaps = 8/215 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAY--PLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           PY+ L+R     G  L ++PC W  +LA       R G L      W       GA + R
Sbjct: 31  PYLRLSRADRPIGTWLLLIPCWWGLMLAILWDQSPRWGDL------WIFAACAAGAWLMR 84

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CTWND+ D + D QV RTRSRP+PSGQ T   A ++  LQ LIS  +LL FN   I 
Sbjct: 85  GAGCTWNDITDRNFDGQVERTRSRPIPSGQVTVTGAFIWMGLQALISLGILLSFNQAAIA 144

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +G   LF   +YPF+KRF   PQV LG+ F  G  + W A   + +WP   L +  I W 
Sbjct: 145 MGILALFPVAIYPFAKRFTWWPQVFLGLAFNWGAMLAWVAHTGTLNWPPVILYLAGIAWT 204

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
           +++DT+YAHQD +DD LIGV STARLF  QT +WL
Sbjct: 205 LFYDTIYAHQDTEDDALIGVKSTARLFGTQTPMWL 239


>gi|254449713|ref|ZP_05063150.1| 4-hydroxybenzoate polyprenyl transferase [Octadecabacter
           antarcticus 238]
 gi|198264119|gb|EDY88389.1| 4-hydroxybenzoate polyprenyl transferase [Octadecabacter
           antarcticus 238]
          Length = 319

 Score =  175 bits (444), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 109/296 (36%), Positives = 152/296 (51%), Gaps = 16/296 (5%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           P++ L+R     G  L +LPC WS  LA     RA +       W      +GA + RGA
Sbjct: 31  PFLRLSRADRPVGTWLLLLPCWWSLALAMLHTGRASLFD----LWIAIGCAIGAFLMRGA 86

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D DID  V RT +RP+P GQ    +ALV+  LQ  ++ ++LL FN   + +G
Sbjct: 87  GCTWNDITDRDIDGSVSRTANRPIPLGQIGVRKALVWMALQSFLALLILLTFNSNAVLLG 146

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L    +YPF+KRF   PQV LG+ F  G  + W A   S  WPA  L +  I W ++
Sbjct: 147 ILALLPVAIYPFAKRFTWWPQVFLGLAFNWGALLAWTAHTGSLGWPAVALYLAGIAWTLF 206

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVNFFAW 258
           +DT+YAHQD +DD LIGV STARLF   T LWL  F++  + +L   V    +  N  A 
Sbjct: 207 YDTIYAHQDVEDDALIGVKSTARLFGDATPLWLRYFMVATVCLLGLAVILAGMNANVLA- 265

Query: 259 IGLLIAL-------FLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
             L++AL       +    +    D   S +    F S    G++ L    ++LF+
Sbjct: 266 --LVVALGGPWAMGWHLAWQQRGFDADDSSKLLRLFRSNRDAGLIPLPFFAVALFV 319


>gi|260426816|ref|ZP_05780795.1| 4-hydroxybenzoate polyprenyl transferase [Citreicella sp. SE45]
 gi|260421308|gb|EEX14559.1| 4-hydroxybenzoate polyprenyl transferase [Citreicella sp. SE45]
          Length = 322

 Score =  175 bits (443), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 154/291 (52%), Gaps = 21/291 (7%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R     G  L +LPC W  +LA   +   G   W  + W      +GA + RGA
Sbjct: 33  PYLRLSRADRPIGTWLLLLPCWWGLLLA---MVSDGQARWFDL-WIFLGCGIGAFLMRGA 88

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D D D  V RT SRP+PSGQ +  QAL +AV+Q L+SF +L+ F P  I +G
Sbjct: 89  GCTWNDITDRDFDGSVARTASRPIPSGQVSARQALAWAVIQSLVSFGILVTFPPMAILLG 148

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L    +YPF+KRF   PQV LGI F  G  + W A   S   PA  L +  + W ++
Sbjct: 149 VVSLLPVAVYPFAKRFTWWPQVFLGIAFNWGALLAWTAHTGSLGLPAVLLYLSGMAWTLF 208

Query: 201 FDTVYAHQDKKDDELIGVNSTARLF-SYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
           +DT+YAHQDK+DD LIGV STARLF    T  W   L G  V+   VA   L +   A  
Sbjct: 209 YDTIYAHQDKEDDALIGVKSTARLFGDAATPKW---LAGFLVIS--VALMGLAIVAAAPR 263

Query: 260 GLLIALFLTIK-----------RIIALDISCSKQCCSFFHSAGVVGILILI 299
           G ++AL + I            ++  LD++ + +    F S    G+L ++
Sbjct: 264 GEILALVVLIAGPWAFGWHMMWQMRRLDVNDNDRLLMLFRSNRDAGMLPVL 314


>gi|163745647|ref|ZP_02153007.1| 4-hydroxybenzoate polyprenyl transferase [Oceanibulbus indolifex
           HEL-45]
 gi|161382465|gb|EDQ06874.1| 4-hydroxybenzoate polyprenyl transferase [Oceanibulbus indolifex
           HEL-45]
          Length = 355

 Score =  175 bits (443), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 99/229 (43%), Positives = 131/229 (57%), Gaps = 11/229 (4%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
            WV D     A+ PY+ L+R     G  L +LPC W   LA        +   S  +  L
Sbjct: 54  NWV-DRHAPRALRPYLRLSRADRPIGTWLLLLPCWWGLSLAI-------LFDQSPRWEDL 105

Query: 68  FIYI---VGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLI 124
           +I++   +GA + RGA CTWND+ D +ID +V RTRSRP+PSG  T  QAL + VLQ L+
Sbjct: 106 WIFMGCAIGAFLMRGAGCTWNDITDRNIDGKVARTRSRPIPSGAVTVKQALAWMVLQMLV 165

Query: 125 SFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFS 184
           + V+LL FN   I +G   L    +YPF+KRF   PQV LG+ F  G  + W A   +  
Sbjct: 166 ALVILLTFNQAAIAMGVLALLPVAVYPFAKRFTWWPQVFLGLAFNWGAMLAWTAHAGTLH 225

Query: 185 WPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
            PA  L +  I W +++DT+YAHQD +DD LIGV STARLF   +  WL
Sbjct: 226 APAIVLYLAGIAWTLFYDTIYAHQDAEDDALIGVKSTARLFGENSGQWL 274


>gi|163732850|ref|ZP_02140295.1| 4-hydroxybenzoate polyprenyl transferase [Roseobacter litoralis Och
           149]
 gi|161394210|gb|EDQ18534.1| 4-hydroxybenzoate polyprenyl transferase [Roseobacter litoralis Och
           149]
          Length = 320

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 114/310 (36%), Positives = 159/310 (51%), Gaps = 18/310 (5%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
            WV D    +A  PY+ L+R     G  L +LPC W   L+    ++A         W  
Sbjct: 19  NWV-DVYAPAAARPYLRLSRADRPIGTWLLLLPCWWGLSLSMLYDQQASWFD----LWIA 73

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
                GA + RGA CTWND+ D D D QV RTRSRP+PSGQ T   A+++  LQ L++F 
Sbjct: 74  IGCAFGAWLMRGAGCTWNDITDRDFDGQVERTRSRPIPSGQVTLRGAVIWMCLQALLAFC 133

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           +LL FN   I +G   L    +YPF+KRF   PQV LG+ F  G  + W A       PA
Sbjct: 134 ILLTFNLAAIGLGILALLPVAIYPFAKRFTWWPQVFLGLAFNWGALLAWTAHSGQLDAPA 193

Query: 188 FFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFM 245
             L    I W +++DT+YAHQD +DD LIG+ STARLF  +T  WL  F++  + ++   
Sbjct: 194 VVLYAAGIAWTLFYDTIYAHQDTEDDALIGIKSTARLFGNKTAAWLRRFLMATVGLMGVA 253

Query: 246 VAFCLL-TVNFFAWIGLLIAL-------FLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
           V F ++   N  A   L++AL       +    ++  LD   + +    F S    GI+ 
Sbjct: 254 VIFAVMPAANMLA---LVVALGGPWAMGWHMAWQLRGLDTDDNAKLLQLFRSNRDTGIIP 310

Query: 298 LICLIISLFL 307
           L+   I+L L
Sbjct: 311 LVFFGIALLL 320


>gi|84515819|ref|ZP_01003180.1| 4-hydroxybenzoate polyprenyl transferase [Loktanella vestfoldensis
           SKA53]
 gi|84510261|gb|EAQ06717.1| 4-hydroxybenzoate polyprenyl transferase [Loktanella vestfoldensis
           SKA53]
          Length = 321

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 135/247 (54%), Gaps = 5/247 (2%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
            WV D +  +   PY+ L+R     G  L  LPCLW+  LA     R      S   W +
Sbjct: 21  NWV-DRLAPAPTRPYLRLSRADRPIGTWLLYLPCLWALGLAVIATGRFD----SFAIWII 75

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
               +GA + RGA CTWND+ D DID  V RTRSRP+PSGQ +   A+++ + Q L++F 
Sbjct: 76  AGCGIGAFLMRGAGCTWNDITDRDIDGSVARTRSRPIPSGQTSVKAAVIWMIAQALVAFG 135

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           +L+ F P  I +G   L    +YPF+KRF   PQV LG+ F  G  + W A   S     
Sbjct: 136 ILITFPPAAIVLGILALLPVAVYPFAKRFTWWPQVFLGLAFNWGALLAWAAHTGSIGPAP 195

Query: 188 FFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA 247
           F L +  I W +++DTVYA+QD +DD LIGV STARLF    + WL +   + V+ F  A
Sbjct: 196 FVLYLAGIAWTLFYDTVYAYQDAEDDALIGVKSTARLFGDTARWWLRLFLALTVILFGAA 255

Query: 248 FCLLTVN 254
             L T +
Sbjct: 256 VVLATQD 262


>gi|188580092|ref|YP_001923537.1| 4-hydroxybenzoate polyprenyl transferase [Methylobacterium populi
           BJ001]
 gi|179343590|gb|ACB79002.1| 4-hydroxybenzoate polyprenyl transferase [Methylobacterium populi
           BJ001]
          Length = 316

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 91/236 (38%), Positives = 133/236 (56%)

Query: 66  YLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLIS 125
           +L ++++GA+  RGA  T+ND+ D  +D+QV RTRSRPLPSGQ T  QA  F V Q L+ 
Sbjct: 71  HLVLFLIGAVAMRGAGSTYNDIADRRLDAQVERTRSRPLPSGQVTTKQAAAFLVAQALVG 130

Query: 126 FVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW 185
             +LLQFN   I VG   L    +YPF KR +  PQ VLG+ F+ G  +GW A+      
Sbjct: 131 LAVLLQFNAAAILVGMLSLAPVAIYPFMKRVMPMPQAVLGLAFSWGALMGWVAVFGRLDP 190

Query: 186 PAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFM 245
           PA +L  GTI WVV +DT+YA QD +DDE++G++S+ARLF  + +L + + Y      F+
Sbjct: 191 PALWLYAGTICWVVGYDTIYAVQDIEDDEIVGIHSSARLFGARLRLAVGLCYAGTAALFV 250

Query: 246 VAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICL 301
            A          W+GL +       +++ L      +  + F S    G+++   L
Sbjct: 251 PALLGAGAGPLGWLGLALFAGHLAGQVMRLSERDGARALALFRSNRNAGLILFAGL 306


>gi|85703483|ref|ZP_01034587.1| 4-hydroxybenzoate polyprenyl transferase [Roseovarius sp. 217]
 gi|85672411|gb|EAQ27268.1| 4-hydroxybenzoate polyprenyl transferase [Roseovarius sp. 217]
          Length = 321

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 127/233 (54%), Gaps = 5/233 (2%)

Query: 1   MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGW 60
           ++  +   WV D +  +A  PY+ LAR     G  L +LPC W   LA   +   G  GW
Sbjct: 14  VADAYAGNWV-DRLAPAATRPYLRLARADRPIGTWLLLLPCWWGLTLA---MLSDGQAGW 69

Query: 61  STIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVL 120
             + W      +GA + RGA CTWND+ D  ID  V RT SRP+PSGQ T   AL++   
Sbjct: 70  HDL-WIFTGCALGAFLMRGAGCTWNDITDRHIDGSVARTASRPIPSGQVTVRGALIWMAT 128

Query: 121 QFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALH 180
           Q LI+F +LL FN   + +G   L    +YPF+KRF   PQV LG+ F  G  + W A  
Sbjct: 129 QALIAFAILLTFNTAAVALGVLSLLPVAVYPFAKRFTWWPQVFLGLAFNWGALLAWTAHT 188

Query: 181 ASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
                PA  L    I W +++DT+YAHQD +DD LIGV STARLF   +  WL
Sbjct: 189 GQLEAPAVILYFAGIAWTLFYDTIYAHQDAEDDALIGVKSTARLFGDNSPRWL 241


>gi|310815075|ref|YP_003963039.1| 4-hydroxybenzoate polyprenyl transferase [Ketogulonicigenium
           vulgare Y25]
 gi|308753810|gb|ADO41739.1| 4-hydroxybenzoate polyprenyl transferase [Ketogulonicigenium
           vulgare Y25]
          Length = 325

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 129/230 (56%), Gaps = 4/230 (1%)

Query: 18  AIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVT 77
           A+ P++ L+R     G  L +LPC WS +LAA      G  GW  + W      +GA++ 
Sbjct: 28  ALRPWLRLSRIDRPIGTWLLLLPCWWSLLLAAL---SDGRFGWFDL-WIAVGCAIGALLM 83

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           RGA CTWND+ D  ID +V RT  RP+PSGQ +   A V+  +Q LIS  +L  FN   +
Sbjct: 84  RGAGCTWNDITDRHIDGKVARTALRPIPSGQVSVRGAAVWMAVQVLISAAVLFTFNIATV 143

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFW 197
            +G   L   ++YPF+KRF   PQ  LGI F  G  VGW A   S  W    L +G I W
Sbjct: 144 ALGVLALVPVVVYPFAKRFTWWPQAFLGIAFNWGALVGWTAHTGSLGWQPVVLYLGGIAW 203

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA 247
            +++DT+YAHQD +DD LIGV STARLF   T  WL I   + V    +A
Sbjct: 204 TLFYDTIYAHQDFEDDALIGVKSTARLFGDDTPRWLAIFAALTVALTAIA 253


>gi|83941417|ref|ZP_00953879.1| 4-hydroxybenzoate polyprenyl transferase [Sulfitobacter sp. EE-36]
 gi|83847237|gb|EAP85112.1| 4-hydroxybenzoate polyprenyl transferase [Sulfitobacter sp. EE-36]
          Length = 339

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 110/291 (37%), Positives = 154/291 (52%), Gaps = 21/291 (7%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYI---VGAIVT 77
           PY+ L+R     G  L +LPC W   LA        + G    ++ L+I+I    GA + 
Sbjct: 50  PYLRLSRADRPIGTWLLLLPCWWGLTLAM-------LFGQQPRWFDLWIFIGCGAGAWLM 102

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           RGA CTWND+ D  ID +V RTRSRP+PSGQ +   AL + + Q LI+  +LL FN   I
Sbjct: 103 RGAGCTWNDITDRHIDGKVARTRSRPIPSGQVSVKGALAWMIAQMLIALGILLTFNGAAI 162

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFW 197
            +G   L    +YPF+KRF   PQV LGI F  G  + W A   S   PA  L    I W
Sbjct: 163 ALGVLALLPVAVYPFAKRFTWWPQVFLGIAFNWGALLAWTAHTGSLGAPAVVLYAAGIAW 222

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVNF 255
            +++DT+YAHQDK+DD LIGV STARLF   T  WL  F++  + ++   V F L     
Sbjct: 223 TLFYDTIYAHQDKEDDALIGVKSTARLFGDNTGHWLRRFLIATVGLMGLAVIFALRDSAS 282

Query: 256 FAWIGLLIAL-------FLTIKRIIALDISCSKQCCSFFHSAGVVGILILI 299
           F  + ++IAL       +    ++  +DI+ + +    F      G++ L+
Sbjct: 283 F--LAMVIALGGPWAMGWHMAWQLRGIDINDNDKLLRLFRVNRDTGMIPLV 331


>gi|119383377|ref|YP_914433.1| prenyltransferase [Paracoccus denitrificans PD1222]
 gi|119373144|gb|ABL68737.1| 4-hydroxybenzoate octaprenyltransferase [Paracoccus denitrificans
           PD1222]
          Length = 323

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 122/213 (57%), Gaps = 5/213 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           P++ L+R     G  L +LPC W   LA      AG  GW  + W      VGA++ RGA
Sbjct: 38  PWLRLSRADRPIGTWLLLLPCWWGIGLAMI----AGSPGWRDL-WIAVACGVGAVLMRGA 92

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D DID +V RTRSRP+PSGQ T   A+V+ V Q L  F +LL      I +G
Sbjct: 93  GCTWNDITDRDIDDKVARTRSRPIPSGQVTVRGAMVWLVAQSLAGFAILLTLGGAAIALG 152

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L +  +YPF+KRF   PQ+ LG+ F  GV + W A   + +       +  I W ++
Sbjct: 153 VASLLLVAIYPFAKRFTWWPQLFLGLAFNWGVLLAWAAHMGNLAPAPVLAYLAGIAWTIF 212

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
           +DT+YAHQD +DD LIGV STARLF   T  WL
Sbjct: 213 YDTIYAHQDAEDDALIGVKSTARLFGRDTPRWL 245


>gi|254487120|ref|ZP_05100325.1| 4-hydroxybenzoate polyprenyl transferase [Roseobacter sp. GAI101]
 gi|214043989|gb|EEB84627.1| 4-hydroxybenzoate polyprenyl transferase [Roseobacter sp. GAI101]
          Length = 328

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 101/236 (42%), Positives = 135/236 (57%), Gaps = 14/236 (5%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWY-LFIYI---VGAIV 76
           PY+ L+R     G  L +LPC W   LA        +L      W+ L+I+    +GA +
Sbjct: 39  PYLRLSRADRPIGTWLLLLPCWWGLALA--------ILFDQQPRWFDLWIFAGCGLGAFL 90

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CTWND+ D DID++V RTRSRP+PSGQ +   A  + + Q LI+F +LL FN   
Sbjct: 91  MRGAGCTWNDITDRDIDAKVARTRSRPIPSGQVSVKGAAAWMIAQALIAFCILLTFNYAA 150

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I +G   L    +YPF+KRF   PQV LGI F  G  + W A   S + PA  L +  I 
Sbjct: 151 ISLGILALLPVAIYPFAKRFTWWPQVFLGIAFNWGALLAWTAHTGSLAAPAVVLYLAGIA 210

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCL 250
           W +++DT+YAHQD +DD LIGV STARLF   T  WL  F++  + ++   V F L
Sbjct: 211 WTLFYDTIYAHQDTEDDALIGVKSTARLFGENTAQWLRRFLMATVGLMGLAVIFAL 266


>gi|83854894|ref|ZP_00948424.1| 4-hydroxybenzoate polyprenyl transferase [Sulfitobacter sp.
           NAS-14.1]
 gi|83842737|gb|EAP81904.1| 4-hydroxybenzoate polyprenyl transferase [Sulfitobacter sp.
           NAS-14.1]
          Length = 324

 Score =  172 bits (437), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 108/288 (37%), Positives = 149/288 (51%), Gaps = 15/288 (5%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R     G  L +LPC W   LA    ++          W L     GA + RGA
Sbjct: 35  PYLRLSRADRPIGTWLLLLPCWWGLTLAMLSDQQPRWFD----LWILIGCGAGAWLMRGA 90

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D  ID +V RTRSRP+PSGQ +   AL + + Q LI+  +LL FN   I +G
Sbjct: 91  GCTWNDITDRHIDGKVARTRSRPIPSGQVSVKAALAWMIAQMLIALGILLTFNGAAIALG 150

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L    +YPF+KRF   PQV LGI F  G  + W A   S   PA  L    I W ++
Sbjct: 151 VLALLPVAVYPFAKRFTWWPQVFLGIAFNWGALLAWTAHTGSLGAPAVVLYAAGIAWTLF 210

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVNFFAW 258
           +DT+YAHQDK+DD LIGV STARLF   T  WL  F++  + ++   V F L     F  
Sbjct: 211 YDTIYAHQDKEDDALIGVKSTARLFGDNTGHWLRRFLIATVGLMGLAVIFALRDSASF-- 268

Query: 259 IGLLIAL-------FLTIKRIIALDISCSKQCCSFFHSAGVVGILILI 299
           + ++IAL       +    ++  +DI+ + +    F      G++ L+
Sbjct: 269 LAMVIALGGPWAMGWHMAWQLRGIDINDNDKLLRLFRVNRDTGMIPLV 316


>gi|118090200|ref|XP_420564.2| PREDICTED: hypothetical protein [Gallus gallus]
          Length = 356

 Score =  172 bits (436), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 108/292 (36%), Positives = 152/292 (52%), Gaps = 18/292 (6%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY++L R H   G  L  LPC WS  LAA P       G    +  L ++  GA++ R
Sbjct: 59  LRPYLHLMRLHQPAGTWLLYLPCTWSIGLAAEP-------GCLPDWHMLALFGAGAVLMR 111

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT NDL D D D QV RT  RPL +G+ + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 112 GAGCTINDLWDRDYDKQVARTAGRPLAAGEISTFQSFVFLGGQLSLALCVLLCLNYYSII 171

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW----PAFFLCIGT 194
           +G A L + + YP  KR    PQ+VLG+ F  G  +GW A+H S  W    P +F     
Sbjct: 172 LGAASLSLVVTYPLMKRITYWPQLVLGLTFNWGALLGWSAIHGSCDWSVCLPLYF---SG 228

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLT 252
           + W + +DT+YAHQDK+DD +IGV STA  F   TK WL  F    +  LC     C  T
Sbjct: 229 VMWTLVYDTIYAHQDKRDDIVIGVKSTALKFKEDTKQWLSGFSTAMVSGLCVAGMNCDQT 288

Query: 253 VNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
             +++ +  + A      +I  LDI   + C   F S   VG+L+ + +++ 
Sbjct: 289 FPYYSAVAAVGAHL--AYQIYTLDIDKPEDCWKKFASNRTVGVLLFVGIVLG 338


>gi|159045640|ref|YP_001534434.1| 4-hydroxybenzoate polyprenyltransferase [Dinoroseobacter shibae DFL
           12]
 gi|157913400|gb|ABV94833.1| para-hydroxybenzoate--polyprenyltransferase [Dinoroseobacter shibae
           DFL 12]
          Length = 322

 Score =  172 bits (435), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 109/294 (37%), Positives = 154/294 (52%), Gaps = 21/294 (7%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
            WV D     A  PY+ L+R     G  L ++PC W  +L A     AG        W +
Sbjct: 20  NWV-DRYAPPATRPYLRLSRADRPIGTWLLLIPCWWGALLGAA----AGDGFDRGTAWIM 74

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
               +GA + RGA CTWND+ D D D++V RTRSRP+PSGQ +   ALV+ V+Q L++F 
Sbjct: 75  VGCGIGAFLMRGAGCTWNDITDRDFDAKVARTRSRPIPSGQVSVRGALVWMVVQALLAFG 134

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHAS-FSWP 186
           +LL FN   I +G A L +  +YPF+KRF   PQ+ LG+ F  G  + W A   +    P
Sbjct: 135 ILLSFNLPAIGLGIASLALVCVYPFAKRFTWWPQIFLGLAFNWGALLAWTAETGTLLDAP 194

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV 246
           +  L +  I W +++DT+YAHQD +DD LIGV STARLF  +++ WL    G+F++   V
Sbjct: 195 SVLLYVAGIAWTLFYDTIYAHQDTEDDALIGVKSTARLFGDRSRRWL----GLFLIAATV 250

Query: 247 AFCLLTVNFFAWIGLLIALFLTIKRIIA-----------LDISCSKQCCSFFHS 289
                 +   A +   +AL L +  + A           LD +    C   F S
Sbjct: 251 LAGGAVIAALAPLDAPLALALGLGGVWAFGWHMVWQLRQLDPNDPGNCLRLFRS 304


>gi|323137859|ref|ZP_08072934.1| 4-hydroxybenzoate polyprenyl transferase [Methylocystis sp. ATCC
           49242]
 gi|322396862|gb|EFX99388.1| 4-hydroxybenzoate polyprenyl transferase [Methylocystis sp. ATCC
           49242]
          Length = 316

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 140/244 (57%), Gaps = 6/244 (2%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + P+V LAR     GW L +LPC   + LA+  LR A  L      W+L ++ +GA+V R
Sbjct: 30  LRPFVQLARLDRPVGWWLLLLPCWEGSALASASLREAPNL------WHLTLFFIGAVVMR 83

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA  T+ND VD +ID++V RTR RPL SG+ +   A+ F V Q LI   +LL  N   I 
Sbjct: 84  GAGSTYNDYVDREIDAKVERTRGRPLASGRVSPRAAIWFIVAQCLIGLWVLLSVNGLTIA 143

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +GFA   I LLYPF+KRF   PQ +LG  FA G  +GW +   +   PA  L +  I W 
Sbjct: 144 LGFASPLIVLLYPFAKRFTSWPQAILGTAFAYGALLGWTSRTGALEAPALLLYLAAILWT 203

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+YA QD +DD + GV STARLF    +L +  LY   V+   +A  L     FAW
Sbjct: 204 IGYDTIYALQDLRDDAIAGVRSTARLFGENVQLAVGGLYTGSVISAALAVHLAGGGVFAW 263

Query: 259 IGLL 262
           +G++
Sbjct: 264 LGVV 267


>gi|301614041|ref|XP_002936501.1| PREDICTED: para-hydroxybenzoate--polyprenyltransferase,
           mitochondrial-like [Xenopus (Silurana) tropicalis]
          Length = 387

 Score =  171 bits (432), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 110/292 (37%), Positives = 154/292 (52%), Gaps = 12/292 (4%)

Query: 15  MGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGA 74
           M   + PY+ L R     G  L  LPC WS  LAA P       G       L ++  GA
Sbjct: 90  MPKNVQPYLKLMRLDKPIGTWLLYLPCTWSISLAAEP-------GSFPDLHMLALFGTGA 142

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
           ++ RGA CT ND+ D D D +V RT SRP+ +G  ++FQ+LVF   Q  ++  +LL  N 
Sbjct: 143 VLMRGAGCTINDMWDKDFDKKVQRTASRPIAAGDISQFQSLVFLGGQLSLALSVLLSLNY 202

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIG 193
           + I +G A L + + YP  KR    PQ+VLG+ F  G  +GW A+  S  W     L + 
Sbjct: 203 YSIALGAASLSLVVSYPLMKRITYWPQLVLGMTFNWGCLLGWSAVKGSCDWSVCLPLYVS 262

Query: 194 TIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLL 251
            I W + +DT+YAHQDKKDD L+GV STA  F+ QTK WL  F +  +  L      C  
Sbjct: 263 GIMWTLIYDTIYAHQDKKDDVLVGVKSTALRFNEQTKQWLSGFTVAMMTGLTVTGMSCDQ 322

Query: 252 TVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLII 303
           T  ++  + L+ A      +I  LDI+ ++ C   F S   VGIL+ I +++
Sbjct: 323 TFPYYIAVALIGAQL--THQIYTLDINSAEDCWKKFSSNRNVGILLFIGIVL 372


>gi|84685243|ref|ZP_01013142.1| 4-hydroxybenzoate polyprenyl transferase [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666975|gb|EAQ13446.1| 4-hydroxybenzoate polyprenyl transferase [Rhodobacterales bacterium
           HTCC2654]
          Length = 325

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 108/314 (34%), Positives = 159/314 (50%), Gaps = 12/314 (3%)

Query: 1   MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGW 60
           ++  +   WV D    + + PY  L+R     G  L +LPC W  +L    +   G   W
Sbjct: 17  VADAYTGNWV-DRYAPAPLRPYFRLSRLDRPIGTWLLLLPCWWGLLLG---MGFDGRASW 72

Query: 61  STIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVL 120
             + W      +GA + RGA CTWND+ D  ID  V RTRSRP+P G  +  QAL + V+
Sbjct: 73  HDL-WIAVGCAIGATLMRGAGCTWNDITDRHIDGSVARTRSRPIPWGAVSVPQALAWLVV 131

Query: 121 QFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALH 180
           Q LI+F +L+ F+   I +G   L    +YPF+KRF   PQ+ LGI F  G  + + A  
Sbjct: 132 QALIAFFILITFDTAAIILGIVALAPVAIYPFAKRFTWWPQIFLGIAFNWGALLAFAAHT 191

Query: 181 ASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIF 240
            + +WPA  L +  + W +++DT+YAHQDK+DD LIGV STARLF   T  WL       
Sbjct: 192 GTLAWPAVALYLAGMAWTLFYDTIYAHQDKEDDALIGVKSTARLFGDNTPRWLLAFLVGC 251

Query: 241 VLCFMVAFCLLTVNFFAWIGLLIALFLTIK-------RIIALDISCSKQCCSFFHSAGVV 293
           V    +A     +   + + L++AL            ++  L++     C   F S    
Sbjct: 252 VALMTLAIITAYLPGQSPLALVVALAAPWAMGWHLSWQMRKLEMDDPDTCLMLFRSNRNA 311

Query: 294 GILILICLIISLFL 307
           G++ +  L ++LFL
Sbjct: 312 GLIPVPFLAVALFL 325


>gi|254439510|ref|ZP_05053004.1| 4-hydroxybenzoate polyprenyl transferase [Octadecabacter
           antarcticus 307]
 gi|198254956|gb|EDY79270.1| 4-hydroxybenzoate polyprenyl transferase [Octadecabacter
           antarcticus 307]
          Length = 319

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 132/239 (55%), Gaps = 6/239 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           P++ L+R     G  L +LPC WS  LA     RA +       W      +GA + RGA
Sbjct: 31  PFLRLSRADRPIGTWLLLLPCWWSLALAMLHTGRASLFD----LWIAIGCAIGAFLMRGA 86

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D DID  V RT +RP+PSGQ    +ALV+  LQ  ++ ++LL FN   + +G
Sbjct: 87  GCTWNDITDRDIDGSVERTANRPIPSGQVGVRKALVWMALQSFLALLILLTFNSNAVLLG 146

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L    +YPF+KRF   PQV LG+ F  G  + W A   +  WPA  L +  I W ++
Sbjct: 147 VLALLPVAIYPFAKRFTWWPQVFLGLAFNWGALLAWTAHTGTLGWPAVVLYVAGIAWTLF 206

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVNFFA 257
           +DT+YAHQD +DD LIGV STARLF   T LWL  F++  + +L   V    +  N  A
Sbjct: 207 YDTIYAHQDVEDDALIGVKSTARLFGDATPLWLRYFMVATVCLLGLAVILAGINANVLA 265


>gi|163850330|ref|YP_001638373.1| 4-hydroxybenzoate polyprenyl transferase [Methylobacterium
           extorquens PA1]
 gi|163661935|gb|ABY29302.1| 4-hydroxybenzoate polyprenyl transferase [Methylobacterium
           extorquens PA1]
          Length = 316

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 99/237 (41%), Positives = 136/237 (57%), Gaps = 5/237 (2%)

Query: 12  DCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYI 71
           D +  +   PY+ LAR     GW L +LPC WS  L A      G         +L +++
Sbjct: 22  DRLAPAGARPYLRLARIERPIGWWLLLLPCWWSAALTATAAGNPG-----PHLGHLVLFL 76

Query: 72  VGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQ 131
           +GA+  RGA  T+ND+ D  +D+QV RTRSRPLPSGQ T  QA  F V Q L+   +LLQ
Sbjct: 77  IGAVAMRGAGSTYNDIADRKLDAQVERTRSRPLPSGQVTTKQAAAFLVAQALVGLAVLLQ 136

Query: 132 FNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLC 191
           FN   I VG   L    +YPF KR +  PQ VLG+ F  G  +GW A+      PA +L 
Sbjct: 137 FNATAILVGMLSLAPVAIYPFMKRVMPMPQAVLGLAFGWGALMGWVAVFGRLDPPALWLY 196

Query: 192 IGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAF 248
            GTI W+V +DT+YA QD +DDE++G++S+ARLF  + +L + + Y   +  F+ A 
Sbjct: 197 AGTICWIVGYDTIYAVQDIEDDEIVGIHSSARLFGARLRLAVGLCYAGTIALFVPAL 253


>gi|149202037|ref|ZP_01879010.1| 4-hydroxybenzoate polyprenyl transferase [Roseovarius sp. TM1035]
 gi|149144135|gb|EDM32166.1| 4-hydroxybenzoate polyprenyl transferase [Roseovarius sp. TM1035]
          Length = 321

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 97/233 (41%), Positives = 128/233 (54%), Gaps = 5/233 (2%)

Query: 1   MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGW 60
           ++  +   WV D +  +A  PY+ L+R     G  L +LPC W   LA   +   G  GW
Sbjct: 14  VADAYAGNWV-DRLAPAATRPYLRLSRADRPIGTWLLLLPCWWGLTLA---MLSDGQAGW 69

Query: 61  STIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVL 120
             + W      +GA + RGA CTWND+ D  ID  V RT SRP+PS Q T   AL++  +
Sbjct: 70  HDL-WIFIGCGLGAFLMRGAGCTWNDITDRHIDGSVARTASRPIPSRQVTVRGALIWMAV 128

Query: 121 QFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALH 180
           Q LI+F +LL FN   I +G   L    +YPF+KRF   PQV LG+ F  G  + W A  
Sbjct: 129 QALIAFGILLTFNTAAIVLGILSLLPVAVYPFAKRFTWWPQVFLGLAFNWGALLAWTAHT 188

Query: 181 ASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
                PA  L +  I W +++DT+YAHQD +DD LIGV STARLF   +  WL
Sbjct: 189 GRLETPAVILYLAGIAWTLFYDTIYAHQDAEDDALIGVKSTARLFGDNSPRWL 241


>gi|218460708|ref|ZP_03500799.1| prenyltransferase [Rhizobium etli Kim 5]
          Length = 216

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 113/187 (60%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LARW    GW L + PC WS  LAA      G+   S +  +L +Y +GA+  RGA
Sbjct: 30  PYAQLARWDRPIGWQLLMWPCFWSATLAANAAIDEGLYSGSLLVSHLILYFIGAVAMRGA 89

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT+NDLVDH+ID QV RTRSRPLPSG+ TR  A +F  LQ L+   +LLQFN F + +G
Sbjct: 90  GCTYNDLVDHEIDMQVARTRSRPLPSGRVTRAHAKIFIGLQALVGLFVLLQFNWFTVFLG 149

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L I  LYP++KRF   PQ  LG+ F+ G  +GW  +    S+ +  L   ++ W + 
Sbjct: 150 LLSLGIVALYPYAKRFTDWPQFYLGLAFSWGALMGWAGILGEISFASVLLYAASVAWTIG 209

Query: 201 FDTVYAH 207
           +DT+YAH
Sbjct: 210 YDTIYAH 216


>gi|110681203|ref|YP_684210.1| 4-hydroxybenzoate polyprenyltransferase [Roseobacter denitrificans
           OCh 114]
 gi|109457319|gb|ABG33524.1| 4-hydroxybenzoate polyprenyl transferase [Roseobacter denitrificans
           OCh 114]
          Length = 320

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 109/310 (35%), Positives = 159/310 (51%), Gaps = 18/310 (5%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
            WV D    +A  PY+ L+R     G  L +LPC W   L+    ++A         W  
Sbjct: 19  NWV-DLYAPAATRPYLRLSRADRPIGTWLLLLPCWWGLALSMLYTQQASWFD----LWIA 73

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
               +GA + RGA CTWND+ D D D +V RTRSRP+PSGQ T   A+++   Q +++F 
Sbjct: 74  IGCALGAWLMRGAGCTWNDITDRDFDGRVERTRSRPIPSGQVTVRGAVIWMCAQAVLAFG 133

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           +LL FN   I +G   L    +YPF+KRF   PQV LG+ F  G  + W A       PA
Sbjct: 134 ILLTFNLAAIGLGILALLPVAIYPFAKRFTWWPQVFLGLAFNWGALLAWTAHSGQLDAPA 193

Query: 188 FFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFM 245
             L    I W +++DT+YAHQD +DD LIG+ STARLF  +T  WL  F++  + ++   
Sbjct: 194 VVLYAAGIAWTLFYDTIYAHQDTEDDALIGIKSTARLFGDKTPAWLRRFLMATVGLMGVA 253

Query: 246 VAFCLL-TVNFFAWIGLLIAL-------FLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
           V F ++   N  A   L++AL       +    ++  LD   + +    F +    G++ 
Sbjct: 254 VIFAVMPAANLLA---LVVALGGPWAMGWHMAWQLRGLDTDDNAKLLQLFRANRDTGMIP 310

Query: 298 LICLIISLFL 307
           L+   I+L L
Sbjct: 311 LVFFGIALLL 320


>gi|220920408|ref|YP_002495709.1| 4-hydroxybenzoate polyprenyl transferase [Methylobacterium nodulans
           ORS 2060]
 gi|219945014|gb|ACL55406.1| 4-hydroxybenzoate polyprenyl transferase [Methylobacterium nodulans
           ORS 2060]
          Length = 324

 Score =  169 bits (427), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 96/210 (45%), Positives = 126/210 (60%), Gaps = 5/210 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ LAR     GW L +LPC WS  LAA    R G        W+L ++++GA+  RGA
Sbjct: 39  PYLRLARIERPIGWWLLLLPCWWSASLAAIAAGRVG-----PDLWHLGLFLIGAVAMRGA 93

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
             T+ND+ D D+D++V RTR RPLPSG+     AL F V Q LI   +LLQFN F + VG
Sbjct: 94  GSTYNDIADRDLDARVERTRLRPLPSGRLRVRHALAFLVAQALIGLAVLLQFNRFAVVVG 153

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L    +YPF KR +  PQ+VLG+ FA G  +GW AL      PA +L  G I WV+ 
Sbjct: 154 LFSLAPVAIYPFMKRVMPVPQLVLGLAFAWGALMGWAALIGRLDAPALWLYAGAIAWVIG 213

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
           +DT+YA QD +DDE+ G+ S+AR F  Q +
Sbjct: 214 YDTIYAVQDIEDDEIAGIKSSARFFGSQVR 243


>gi|115732277|ref|XP_001204010.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
 gi|115898775|ref|XP_792747.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
          Length = 364

 Score =  169 bits (427), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 104/291 (35%), Positives = 151/291 (51%), Gaps = 16/291 (5%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S + PY+ L R     G  L  LPC WS  +AA P       G     + L I+ +GA++
Sbjct: 59  SKMQPYLRLIRLDKPIGTWLLYLPCTWSIAMAASP-------GHFPDVYMLGIFGLGALL 111

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT ND+ D D D  V RT+ RPL +G+ T+FQAL F   Q   S  +LL FN + 
Sbjct: 112 MRGAGCTINDMWDKDFDKSVERTKVRPLAAGEITQFQALCFLACQLSASLAILLSFNWYS 171

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTI 195
           + +G + + + + YP  KR    PQ VLG+ F  G  +GW A+H S  W     L +  I
Sbjct: 172 VALGASSMLLVVSYPLMKRITYWPQAVLGMAFNWGAILGWAAIHGSCDWSVVLPLYVAGI 231

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL----FILYGIFVLCFMVAFCLL 251
            W + +DT+Y HQDK DD L+G+ ST+     +TK WL     ++ G  VL    A    
Sbjct: 232 SWTLVYDTIYGHQDKNDDMLLGLKSTSIFMGDRTKQWLSGFGSLMIGGLVLSGYNAE--Q 289

Query: 252 TVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           T+ ++  I L  A      +I  +DI+  + C + FHS   +G++I   ++
Sbjct: 290 TIPYYLAISLAGAQL--ANQIWTVDINKPEDCWNKFHSNKRLGLIIFAGIV 338


>gi|71005862|ref|XP_757597.1| hypothetical protein UM01450.1 [Ustilago maydis 521]
 gi|46097090|gb|EAK82323.1| hypothetical protein UM01450.1 [Ustilago maydis 521]
          Length = 984

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 88/211 (41%), Positives = 120/211 (56%), Gaps = 5/211 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PYV L+R     G  L   PC WS VLA++ +     L ++T  +Y  ++ VGA V RGA
Sbjct: 634 PYVALSRIDKPIGTWLLYWPCGWSIVLASHTMG----LSYTTPLFYTMLFGVGAFVMRGA 689

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT ND+ D  +D  V RT++RPL +G+ T FQAL F  +Q      +L+  N + I +G
Sbjct: 690 GCTINDMWDAKMDRMVERTKARPLAAGEITHFQALCFLGIQLSAGLAVLVNLNLYSIMLG 749

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTIFWVV 199
            + L + +LYP  KR    PQ+VLG  F  G  +GW A+  +  W     L  G+I W +
Sbjct: 750 ASSLGVVVLYPLMKRVTYWPQLVLGFAFNWGAMLGWSAVAGAVDWGVVLPLYAGSILWTL 809

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
            +DT+YAHQDK DD   GV STA LF  +TK
Sbjct: 810 VYDTIYAHQDKVDDVHAGVKSTALLFGDKTK 840


>gi|195452522|ref|XP_002073390.1| GK14102 [Drosophila willistoni]
 gi|194169475|gb|EDW84376.1| GK14102 [Drosophila willistoni]
          Length = 400

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 156/294 (53%), Gaps = 12/294 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
            A  PY  L R     G +L   PC WS  L+A     AG   W  +   L ++  GA++
Sbjct: 87  DATKPYAQLMRIDRPIGTYLLFWPCAWSIGLSA----NAGC--WPDLT-MLGLFATGALI 139

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT NDL D DID++V RTRSRPL SG+ ++F A+VF   Q  +  ++L+Q N   
Sbjct: 140 MRGAGCTINDLWDKDIDAKVERTRSRPLASGKISQFDAIVFLSAQLSLGLLVLVQLNWES 199

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTI 195
           I +G + L + + YP  KR    PQ+VLG+ F  G  +GW A   S +  A   L +  +
Sbjct: 200 ILLGASSLGLVITYPLMKRVTYWPQLVLGMAFNWGALLGWCATQGSVNLAACLPLYLSGV 259

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA--FCLLTV 253
            W + +DT+YAHQDK DD  IGV STA  F   TK+WL       +     A   C  T+
Sbjct: 260 CWTIVYDTIYAHQDKLDDLQIGVKSTALRFGENTKVWLSGFTAAMLTGLSAAGMACDQTL 319

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
            ++A +G++ A    +++I +L+I     C   F S   VG+++ + +++   L
Sbjct: 320 PYYAAVGIVGAHL--VQQIYSLNIDNPSDCAKKFFSNHQVGLILFLGIVLGTLL 371


>gi|89070198|ref|ZP_01157526.1| 4-hydroxybenzoate polyprenyl transferase [Oceanicola granulosus
           HTCC2516]
 gi|89044214|gb|EAR50365.1| 4-hydroxybenzoate polyprenyl transferase [Oceanicola granulosus
           HTCC2516]
          Length = 321

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 131/234 (55%), Gaps = 6/234 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R     G  L +LPC W   L +   + A  L      W      +GA++ RGA
Sbjct: 33  PYLRLSRIDRPIGTWLLLLPCWWGLALGSLS-KGAFTL---HDLWIGIGCGIGAVLMRGA 88

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D DID  V RT  RP+PSG  +  QAL +  +Q L++  +LL FN   I +G
Sbjct: 89  GCTWNDITDRDIDGSVSRTALRPIPSGAVSVKQALGWMAVQALVALAILLTFNTNAILLG 148

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L    +YPF+KRF   PQ+ LG+ F  G  + W A   S +WPAF L +G IFW ++
Sbjct: 149 LLSLLPVAIYPFAKRFTWWPQIFLGLAFNWGALLAWTATTGSLAWPAFVLYLGGIFWTLF 208

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLT 252
           +DT+YAHQD +DD LIGV STARLF   +  WL  F++  + ++ F      L 
Sbjct: 209 YDTIYAHQDAEDDALIGVKSTARLFGDSSPRWLRGFLMGTVLLVGFAALLAALE 262


>gi|254559582|ref|YP_003066677.1| p-hydroxybenzoate octaprenyltransferase [Methylobacterium
           extorquens DM4]
 gi|254266860|emb|CAX22659.1| p-hydroxybenzoate octaprenyltransferase [Methylobacterium
           extorquens DM4]
          Length = 316

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 115/180 (63%)

Query: 66  YLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLIS 125
           +L ++++GA+  RGA  T+ND+ D  +D+QV RTRSRPLPSGQ T  QA  F V Q L+ 
Sbjct: 71  HLVLFLIGAVAMRGAGSTYNDIADRKLDAQVERTRSRPLPSGQVTTKQAAAFLVAQALVG 130

Query: 126 FVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW 185
            V+LLQFN   I VG   L    +YPF KR +  PQ VLG+ F  G  +GW A+      
Sbjct: 131 LVVLLQFNATAILVGMLSLAPVAIYPFMKRVMPMPQAVLGLAFGWGALMGWVAVFGRLDP 190

Query: 186 PAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFM 245
           PA +L  GTI W+V +DT+YA QD +DDE++G++S+ARLF  + +L + + Y   V  F+
Sbjct: 191 PALWLYAGTICWIVGYDTIYAVQDIEDDEIVGIHSSARLFGTRLRLAVGLCYAGTVALFV 250


>gi|195055751|ref|XP_001994776.1| GH17422 [Drosophila grimshawi]
 gi|193892539|gb|EDV91405.1| GH17422 [Drosophila grimshawi]
          Length = 382

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 105/293 (35%), Positives = 154/293 (52%), Gaps = 12/293 (4%)

Query: 18  AIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVT 77
           A  PY  L R     G +L   PC WS  L+A     AG   W  +   L ++  GA++ 
Sbjct: 67  ATKPYAQLMRIDRPIGTYLLFWPCGWSIALSA----DAGC--WPDLT-MLGLFATGALIM 119

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           R A CT ND+ D DID++V RTR RPL SGQ T+  A+VF   Q  +  ++L+Q N   I
Sbjct: 120 RSAGCTINDMWDKDIDAKVERTRGRPLASGQITQLDAIVFLSAQLSLGLLVLVQLNWQSI 179

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTIF 196
            +G + L + + YP  KR    PQ+VLG+ F  G  +GW A   S +W A   L +  + 
Sbjct: 180 LLGASSLGLVITYPLMKRVTYWPQLVLGMCFNWGALLGWCATQGSVNWEACLPLYLSGVC 239

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA--FCLLTVN 254
           W + +DT+YAHQDK DD  IGV STA  F   TK+WL    G  +     A   C  T+ 
Sbjct: 240 WTIVYDTIYAHQDKLDDLQIGVKSTALRFGENTKVWLSGFTGAMLTGLSAAGYACDQTLP 299

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
           ++  +G++ A    +++I +L+I     C   F S   VG+++ + +++   L
Sbjct: 300 YYGAVGIVGAHL--VQQIYSLNIDNPTDCAKKFLSNQQVGLILFLGIVLGTLL 350


>gi|145356728|ref|XP_001422578.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144582821|gb|ABP00895.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 404

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 106/297 (35%), Positives = 153/297 (51%), Gaps = 13/297 (4%)

Query: 9   WVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLF 68
           WV D ++ S++ PY  L R     G  L   PC WS  LAA     AG L  + +   L 
Sbjct: 113 WV-DRVVPSSLVPYAKLVRLDRPIGTALLAWPCFWSIALAA----DAGALPDARL---LG 164

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           ++ VGA++ RGA CT NDL D DID++V RTR+RP+ SG  +  +A++F   Q  +   +
Sbjct: 165 LFGVGALLLRGAGCTVNDLWDRDIDNKVSRTRNRPIASGAVSVPKAILFLGAQLALGLGV 224

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           L+Q N +   +G + L +   YP  KR    PQ  LG+ F  G  +GW A+H S  W A 
Sbjct: 225 LVQLNDYSKILGASSLALVAAYPAMKRITNYPQAFLGLTFNWGALLGWAAVHGSCDWGAV 284

Query: 189 F-LCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFM 245
             L    + W + +DT+YAHQDK DD  +G+ STA  F   TK +L  F L G   LC  
Sbjct: 285 LPLYASGVAWTLVYDTIYAHQDKHDDAKVGIKSTALHFGKDTKKYLGAFALAGTSALCAS 344

Query: 246 VAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
            A+  L   F+  +G+  A      +I  +D+   + C + F S    G L+   ++
Sbjct: 345 GAYVGLDYPFY--VGVATATSHLFWQIATVDLDDREDCAAKFRSNSTYGALVFAGIV 399


>gi|195330736|ref|XP_002032059.1| GM26350 [Drosophila sechellia]
 gi|194121002|gb|EDW43045.1| GM26350 [Drosophila sechellia]
          Length = 365

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 107/294 (36%), Positives = 157/294 (53%), Gaps = 12/294 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           SA  PY  L R     G +L   PC WS  L+A     AG   W  +   L ++  GA++
Sbjct: 48  SAAKPYAQLMRIDRPIGTYLLFWPCAWSIALSA----DAGC--WPDLT-MLGLFGTGALI 100

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT NDL D DID++V RTR RPL SGQ ++F A+VF   Q  +  ++L+Q N   
Sbjct: 101 MRGAGCTINDLWDKDIDAKVERTRLRPLASGQISQFDAIVFLSAQLSLGLLVLVQLNWQS 160

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTI 195
           I +G + L + + YP  KR    PQ+VLG+ F  G  +GW A   S +  A   L +  +
Sbjct: 161 ILLGASSLGLVITYPLMKRVTYWPQLVLGMAFNWGALLGWCATQGSVNLAACLPLYLSGV 220

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA--FCLLTV 253
            W + +DT+YAHQDK DD  IGV STA  F   TK+WL       ++    A   C  T+
Sbjct: 221 CWTIVYDTIYAHQDKLDDLQIGVKSTALRFGENTKVWLSGFTAAMLMGLSAAGWACDQTL 280

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
            ++A +G++ A    +++I +L+I     C   F S   VG+++ + +++   L
Sbjct: 281 PYYAAVGVVGAHL--VQQIYSLNIDNPSDCAKKFISNHQVGLILFLGIVLGTLL 332


>gi|294675944|ref|YP_003576559.1| 4-hydroxybenzoate polyprenyltransferase [Rhodobacter capsulatus SB
           1003]
 gi|294474764|gb|ADE84152.1| 4-hydroxybenzoate polyprenyltransferase [Rhodobacter capsulatus SB
           1003]
          Length = 323

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/235 (42%), Positives = 126/235 (53%), Gaps = 10/235 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAY--PLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           PY+ L+R     G  L +LPC WS  LAA    LR           W      +GA + R
Sbjct: 35  PYLRLSRADRPIGTWLLLLPCWWSIALAAATDSLR-------PFDLWLALGCGLGAFLMR 87

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CTWND+ D D D +V RTRSRP+PSGQ +  QA+ + V Q  ++  +L  FN   I 
Sbjct: 88  GAGCTWNDITDRDFDGKVARTRSRPIPSGQVSVKQAVGWMVAQTALAAAILFTFNWAAIG 147

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +G   L    +YPF+KRF   PQ  LGI F  G  +GW A   S       L    I W 
Sbjct: 148 MGVLALVPVAVYPFAKRFTWWPQAFLGIAFNWGALLGWVAHKGSLGLAPVLLYAAGIIWT 207

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTV 253
           +++DT+YAHQDK+DD LIGV STARLF   T  WL  L+ I  +  M A  LL +
Sbjct: 208 LFYDTIYAHQDKEDDALIGVKSTARLFGANTHRWL-TLFLILTVVLMTAAVLLAL 261


>gi|21355567|ref|NP_649789.1| coenzyme Q biosynthesis protein 2 [Drosophila melanogaster]
 gi|74869153|sp|Q9VHS7|COQ2_DROME RecName: Full=4-hydroxybenzoate polyprenyltransferase,
           mitochondrial; AltName: Full=Coenzyme Q biosynthesis
           protein 2; AltName:
           Full=Para-hydroxybenzoate--polyprenyltransferase;
           Short=PHB:polyprenyltransferase; Flags: Precursor
 gi|7299020|gb|AAF54222.1| coenzyme Q biosynthesis protein 2 [Drosophila melanogaster]
 gi|19527955|gb|AAL90092.1| AT17730p [Drosophila melanogaster]
 gi|220949886|gb|ACL87486.1| Coq2-PA [synthetic construct]
          Length = 392

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 108/294 (36%), Positives = 156/294 (53%), Gaps = 12/294 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           SA  PY  L R     G +L   PC WS  L+A     AG   W  +   L ++  GA++
Sbjct: 75  SAAKPYAQLMRIDRPIGTYLLFWPCAWSIALSA----DAGC--WPDLT-MLGLFGTGALI 127

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT NDL D DID++V RTR RPL SGQ ++F A+VF   Q  +  ++L+Q N   
Sbjct: 128 MRGAGCTINDLWDKDIDAKVERTRLRPLASGQISQFDAIVFLSAQLSLGLLVLVQLNWQS 187

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTI 195
           I +G + L + + YP  KR    PQ+VLG+ F  G  +GW A   S +  A   L +  +
Sbjct: 188 ILLGASSLGLVITYPLMKRVTYWPQLVLGMAFNWGALLGWCATQGSVNLAACLPLYLSGV 247

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA--FCLLTV 253
            W + +DT+YAHQDK DD  IGV STA  F   TK+WL       +     A   C  TV
Sbjct: 248 CWTIVYDTIYAHQDKLDDLQIGVKSTALRFGENTKVWLSGFTAAMLTGLSAAGWACDQTV 307

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
            ++A +G++ A    +++I +L+I     C   F S   VG+++ + +++   L
Sbjct: 308 PYYAAVGVVGAHL--VQQIYSLNIDNPSDCAKKFISNHQVGLILFLGIVLGTLL 359


>gi|125775189|ref|XP_001358846.1| GA21912 [Drosophila pseudoobscura pseudoobscura]
 gi|121990981|sp|Q298G6|COQ2_DROPS RecName: Full=4-hydroxybenzoate polyprenyltransferase,
           mitochondrial; AltName: Full=Coenzyme Q biosynthesis
           protein 2; AltName:
           Full=Para-hydroxybenzoate--polyprenyltransferase;
           Short=PHB:polyprenyltransferase; Flags: Precursor
 gi|54638587|gb|EAL27989.1| GA21912 [Drosophila pseudoobscura pseudoobscura]
          Length = 397

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 157/294 (53%), Gaps = 12/294 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           +A  PY  L R     G +L   PC WS  L+A     AG   W  +   L ++  GA++
Sbjct: 81  AATKPYAQLMRIDRPIGTYLLFWPCAWSIALSA----DAGC--WPDLT-MLGLFGTGALI 133

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT NDL D DID++V RTR+RPL SGQ ++F A+VF   Q  +  ++L+Q N   
Sbjct: 134 MRGAGCTINDLWDKDIDAKVERTRTRPLASGQISQFDAIVFLSAQLSLGLLVLVQLNWQS 193

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTI 195
           I +G + L + + YP  KR    PQ+VLG+ F  G  +GW A   S +  A   L +  +
Sbjct: 194 ILLGASSLGLVITYPLMKRVTYWPQLVLGMAFNWGALLGWCATQGSVNLAACLPLYLSGV 253

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA--FCLLTV 253
            W + +DT+YAHQDK DD  IGV STA  F   TK+WL       +     A   C  T+
Sbjct: 254 CWTIVYDTIYAHQDKLDDLQIGVKSTALRFGENTKVWLSGFTAAMLTGLSTAGWACDQTL 313

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
            ++A +G++ A    +++I +L+I     C   F S   VG+++ + +++   L
Sbjct: 314 PYYAAVGVVGAHL--VQQIYSLNIDNPTDCAKKFLSNHQVGLILFLGIVLGTLL 365


>gi|195499070|ref|XP_002096792.1| GE24856 [Drosophila yakuba]
 gi|194182893|gb|EDW96504.1| GE24856 [Drosophila yakuba]
          Length = 392

 Score =  167 bits (422), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 108/294 (36%), Positives = 155/294 (52%), Gaps = 12/294 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           SA  PY  L R     G +L   PC WS  L+A     AG   W  +   L ++  GA++
Sbjct: 75  SAAKPYAQLMRIDRPIGTYLLFWPCAWSIALSA----DAGC--WPDLT-MLGLFGTGALI 127

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT NDL D DID++V RTR RPL SGQ ++F A+VF   Q  +  ++L+Q N   
Sbjct: 128 MRGAGCTINDLWDKDIDAKVERTRLRPLASGQISQFDAIVFLSAQLSLGLLVLVQLNWQS 187

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTI 195
           I +G + L + + YP  KR    PQ+VLG+ F  G  +GW A   S +  A   L +  +
Sbjct: 188 ILLGASSLGLVITYPLMKRVTYWPQLVLGMAFNWGALLGWCATQGSVNLAACLPLYLSGV 247

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA--FCLLTV 253
            W + +DT+YAHQDK DD  IGV STA  F   TK WL       +     A   C  TV
Sbjct: 248 CWTIVYDTIYAHQDKLDDLQIGVKSTALRFGENTKAWLSGFTAAMLTGLSAAGWACDQTV 307

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
            ++A +G++ A    +++I +L+I     C   F S   VG+++ + +++   L
Sbjct: 308 PYYAAVGVVGAHL--VQQIYSLNIDNPSDCAKKFLSNHKVGLILFLGIVLGTLL 359


>gi|170751752|ref|YP_001758012.1| 4-hydroxybenzoate polyprenyl transferase [Methylobacterium
           radiotolerans JCM 2831]
 gi|170658274|gb|ACB27329.1| 4-hydroxybenzoate polyprenyl transferase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 315

 Score =  167 bits (422), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/246 (34%), Positives = 133/246 (54%)

Query: 65  WYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLI 124
           W+  ++++GA+  RGA  T+ND+ D D+D+QV RTR RPLPSGQ     A +F V+Q LI
Sbjct: 69  WHCLLFLIGAVAMRGAGSTYNDIADRDLDAQVERTRLRPLPSGQVRPRHAALFLVIQALI 128

Query: 125 SFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFS 184
              +LLQFN   + +G   L    +YPF KR +  PQ +LG+ FA G  +GW A+ A   
Sbjct: 129 GLAVLLQFNAEAVVIGLCSLLPVAIYPFMKRVMPMPQAILGLAFAWGALMGWAAVFARLD 188

Query: 185 WPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCF 244
            PA  L  G + WV+ +DT+YA QD +DDE+ G+ S+ARLF    +L + + Y +  L  
Sbjct: 189 PPALLLYAGALCWVIGYDTIYAVQDIEDDEIAGIRSSARLFGRHVRLAVGLCYALAALFV 248

Query: 245 MVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           ++A          ++G+         ++++L     +   + F S    G+++ + L   
Sbjct: 249 VLAARGAGAGPVGYLGIAAFAGHLAWQVLSLRERDGRGALTLFRSNRDAGLILFVGLTAD 308

Query: 305 LFLDQF 310
             L   
Sbjct: 309 ALLRNL 314


>gi|218528887|ref|YP_002419703.1| 4-hydroxybenzoate polyprenyl transferase [Methylobacterium
           chloromethanicum CM4]
 gi|218521190|gb|ACK81775.1| 4-hydroxybenzoate polyprenyl transferase [Methylobacterium
           chloromethanicum CM4]
          Length = 316

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 115/183 (62%)

Query: 66  YLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLIS 125
           +L ++++GA+  RGA  T+ND+ D  +D+QV RTRSRPLPSGQ T  QA  F V Q L+ 
Sbjct: 71  HLVLFLIGAVAMRGAGSTYNDIADRKLDAQVERTRSRPLPSGQVTTKQAAAFLVTQALVG 130

Query: 126 FVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW 185
             +LLQFN   I VG   L    +YPF KR +  PQ VLG+ F  G  +GW A+      
Sbjct: 131 LAVLLQFNATAILVGMLSLAPVAIYPFMKRVMPMPQAVLGLAFGWGALMGWVAVFGRLDP 190

Query: 186 PAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFM 245
           PA +L  GTI W+V +DT+YA QD +DDE++G++S+ARLF  + +L + + Y   +  F+
Sbjct: 191 PALWLYAGTICWIVGYDTIYAVQDIEDDEIVGIHSSARLFGARLRLAVGLCYAGTIALFV 250

Query: 246 VAF 248
            A 
Sbjct: 251 PAL 253


>gi|126734661|ref|ZP_01750407.1| 4-hydroxybenzoate polyprenyl transferase [Roseobacter sp. CCS2]
 gi|126715216|gb|EBA12081.1| 4-hydroxybenzoate polyprenyl transferase [Roseobacter sp. CCS2]
          Length = 321

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 97/231 (41%), Positives = 127/231 (54%), Gaps = 6/231 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L+R     G  L   PCLW   LA       G     +  W +    +GA + RGA
Sbjct: 33  PYLRLSRADRPIGTWLLYAPCLWGLALAMLATDSYG----PSDAWIIIGCGIGAFLMRGA 88

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D DID  V RTRSRP+P+GQ T   ALV+ V+Q L++FV+L+ F    I +G
Sbjct: 89  GCTWNDISDRDIDGSVERTRSRPIPAGQATVRGALVWMVVQALLAFVILISFPTTAIILG 148

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW-PAFFLCIGTIFWVV 199
              L    +YPF+KRF   PQ+ LG+ F  G  + W A   S    P    C G I W +
Sbjct: 149 ILALVPVAIYPFAKRFTWWPQLFLGLAFNWGALLAWAAHTNSIGPVPIVLYCAG-IAWTL 207

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCL 250
           ++DT+YAHQD +DD LIGV STARLF   +  WL     I ++ F +A  L
Sbjct: 208 FYDTIYAHQDAEDDALIGVKSTARLFGENSSKWLRFFLTITIVLFGLAVLL 258


>gi|327273018|ref|XP_003221280.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase,
           mitochondrial-like [Anolis carolinensis]
          Length = 375

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 145/288 (50%), Gaps = 14/288 (4%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           I PY+ L R     G  L  LPC WS  LAA P       G    +  L ++  GA++ R
Sbjct: 67  IQPYLRLMRLDKPIGTWLLYLPCTWSIALAAEP-------GCLPAWDMLLLFGTGAVLMR 119

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT SRPL +G+ + F +LVF   Q  ++  +LL  N + I 
Sbjct: 120 GAGCTINDMWDRDYDKKVERTASRPLAAGEISSFHSLVFLGGQLSLALCVLLCLNYYSIA 179

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW----PAFFLCIGT 194
           +G A L + + YP  KR    PQ+ LG+ F  G  +GW A+  S +W    P +F     
Sbjct: 180 LGAASLSLVVTYPLMKRVTYWPQLFLGLTFNWGALLGWSAIQGSCNWSVCLPLYF---SG 236

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
           I W + +DT+YAHQD++DD  IGV STA  F   TK WL     + +L   V        
Sbjct: 237 ILWTLTYDTIYAHQDRRDDLAIGVKSTALRFRENTKQWLSGFSTMMLLGLTVTGMNCDQT 296

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           F  +  +    F   ++I  LDI   + C   F S   VG+L+ I ++
Sbjct: 297 FPYYAAVTAVGFHLARQIYTLDIHSPEDCWKKFSSNRTVGLLLFIGIV 344


>gi|240137402|ref|YP_002961873.1| p-hydroxybenzoate octaprenyltransferase [Methylobacterium
           extorquens AM1]
 gi|240007370|gb|ACS38596.1| p-hydroxybenzoate octaprenyltransferase [Methylobacterium
           extorquens AM1]
          Length = 316

 Score =  166 bits (421), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 115/183 (62%)

Query: 66  YLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLIS 125
           +L ++++GA+  RGA  T+ND+ D  +D+QV RTRSRPLPSGQ T  QA  F V Q L+ 
Sbjct: 71  HLVLFLIGAVAMRGAGSTYNDIADRKLDAQVERTRSRPLPSGQVTTKQAAAFLVAQALVG 130

Query: 126 FVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW 185
             +LLQFN   I VG   L    +YPF KR +  PQ VLG+ F  G  +GW A+      
Sbjct: 131 LAVLLQFNATAILVGMLSLAPVAIYPFMKRVMPMPQAVLGLAFGWGALMGWVAVFGRLDP 190

Query: 186 PAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFM 245
           PA +L  GTI W+V +DT+YA QD +DDE++G++S+ARLF  + +L + + Y   +  F+
Sbjct: 191 PALWLYAGTICWIVGYDTIYAVQDIEDDEIVGIHSSARLFGARLRLAVGLCYAGTIALFV 250

Query: 246 VAF 248
            A 
Sbjct: 251 PAL 253


>gi|195110947|ref|XP_002000041.1| GI22751 [Drosophila mojavensis]
 gi|193916635|gb|EDW15502.1| GI22751 [Drosophila mojavensis]
          Length = 383

 Score =  166 bits (421), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 106/296 (35%), Positives = 157/296 (53%), Gaps = 12/296 (4%)

Query: 15  MGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGA 74
           +  A  PY  L R     G +L   PC WS  L+A     AG   W   F  L ++ +GA
Sbjct: 64  LADAAKPYAQLMRIDRPIGTYLLFWPCGWSIALSA----DAGC--WPD-FSMLGLFALGA 116

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
           ++ RGA CT ND+ D DID++V RTR+RPL SGQ T+F A+VF   Q  +  ++L+Q N 
Sbjct: 117 LIMRGAGCTINDMWDKDIDAKVERTRTRPLASGQITQFDAIVFLSAQLSLGLLVLVQLNW 176

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIG 193
             I +G + L + + YP  KR    PQ+VLG+ F  G  +GW A   S +  A   L + 
Sbjct: 177 QSILLGASSLGLVITYPLMKRVTYWPQLVLGMCFNWGALLGWCATQGSVNLEACLPLYLS 236

Query: 194 TIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA--FCLL 251
            + W + +DT+YAHQDK DD  IGV STA  F   TK+WL       +     A   C  
Sbjct: 237 GVCWTIVYDTIYAHQDKLDDLQIGVKSTALRFGENTKVWLSCFTAAMLAGLTSAGYACDQ 296

Query: 252 TVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
           T+ ++  +G++ A    +++I +L+I     C   F S   VG+++ + +++   L
Sbjct: 297 TLPYYTAVGVVGAHL--VQQIYSLNIDNPSDCAKKFLSNQQVGLILFLGIVLGTLL 350


>gi|291001205|ref|XP_002683169.1| predicted protein [Naegleria gruberi]
 gi|284096798|gb|EFC50425.1| predicted protein [Naegleria gruberi]
          Length = 311

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 152/293 (51%), Gaps = 12/293 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           ++I PY+ L R     G  L + PCLWS  LA        +       +Y  ++ +G+I+
Sbjct: 7   ASIRPYLRLMRLDKPIGTWLLLYPCLWSLGLA-------DINSLIPSPYYASLFAIGSII 59

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT NDL D D D +V RT++RP+ SG+ +    ++F   Q L    +L+QFN + 
Sbjct: 60  MRGAGCTVNDLWDRDFDKKVERTKTRPIASGEISVRNGIIFLGAQLLTGLAVLVQFNMYT 119

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTI 195
           I VG + LF+   YP  KR    PQ  LG+ F  G FVG+ AL     W     L +G+I
Sbjct: 120 IAVGASSLFLVFTYPLMKRITYWPQSYLGLTFNWGAFVGYSALAGFCDWSIVVPLYLGSI 179

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT+YAHQDKKDD+ IGV STA LF  +T+  L     IF     +       +F
Sbjct: 180 AWTIVYDTIYAHQDKKDDKQIGVKSTALLFGERTREILTGFSLIFGALMTITGYNAGYDF 239

Query: 256 FA----WIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
                 +  +  +L   + +I  +D + S+QC   F     +G++I I +I++
Sbjct: 240 IEQWPYYTAVYSSLLAAVYKIHTIDYNNSEQCMKTFVQNKWIGLVIFIGIILA 292


>gi|147899396|ref|NP_001082955.1| para-hydroxybenzoate--polyprenyltransferase, mitochondrial [Danio
           rerio]
 gi|126631738|gb|AAI34044.1| Zgc:162600 protein [Danio rerio]
          Length = 378

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 152/289 (52%), Gaps = 12/289 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           +++ PY+ L R     G  L  LPC WS  LAA P       G       L ++ VGA++
Sbjct: 77  ASVQPYLRLMRLDKPIGTWLLYLPCTWSIGLAADP-------GCLPDLRMLTLFGVGALL 129

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT ND+ D D D +V RT +RP+ SG  TRFQALVF   Q  ++  +LL  N + 
Sbjct: 130 MRGAGCTINDMWDKDFDKKVSRTATRPIASGDITRFQALVFLGGQLSLALGVLLSLNYYS 189

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTI 195
           I +G A L + + YP  KR    PQ +LG+ F  G  +GW A+  S  W     L +  +
Sbjct: 190 IALGAASLSLVVTYPLMKRITYWPQFILGLTFNWGALLGWSAVKGSCDWSVCLPLYVSGV 249

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA--FCLLTV 253
            W + +DT+YAHQDK DD  +GV STA  F   TKLWL    G  +   ++A      T 
Sbjct: 250 MWTLIYDTIYAHQDKDDDLKVGVKSTALRFQENTKLWLSGFTGAMLSGLLLAGVNADQTA 309

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
            ++  +   +AL L   +I ++DI+  + C   F S   +G+L+ + ++
Sbjct: 310 PYYCAVS-AVALHLA-HQIYSVDINRPEDCWKKFASNRNLGLLLFLGIV 356


>gi|195391784|ref|XP_002054540.1| GJ22752 [Drosophila virilis]
 gi|194152626|gb|EDW68060.1| GJ22752 [Drosophila virilis]
          Length = 383

 Score =  165 bits (418), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 106/296 (35%), Positives = 156/296 (52%), Gaps = 12/296 (4%)

Query: 15  MGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGA 74
           + +A  PY  L R     G +L   PC WS  L+A     AG   W   F  L ++  GA
Sbjct: 64  LAAATKPYAQLMRIDRPIGTYLLFWPCGWSIALSA----DAGC--WPD-FTMLALFATGA 116

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
           ++ RGA CT ND+ D DID++V RTR+RPL SGQ T+  A+VF   Q  +  ++L+Q N 
Sbjct: 117 LIMRGAGCTINDMWDKDIDAKVERTRTRPLASGQITQLDAIVFLSAQLSLGLLVLVQLNW 176

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIG 193
             I +G + L + + YP  KR    PQ+VLG+ F  G  +GW A   S +  A   L + 
Sbjct: 177 QSILLGASSLGLVITYPLMKRVTYWPQLVLGMCFNWGALLGWCATQGSVNLDACLPLYLS 236

Query: 194 TIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA--FCLL 251
            + W + +DT+YAHQDK DD  IGV STA  F   TK WL       +     A   C  
Sbjct: 237 GVCWTIVYDTIYAHQDKLDDLQIGVKSTALRFGENTKAWLSGFTAAMLAGLSAAGYACDQ 296

Query: 252 TVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
           T+ ++A +G++ A    +++I +L+I     C   F S   VG+++ + +++   L
Sbjct: 297 TLPYYAAVGVVGAHL--VQQIYSLNIDNPSDCAKKFISNHQVGLILFLGIVLGTLL 350


>gi|194744203|ref|XP_001954584.1| GF16669 [Drosophila ananassae]
 gi|190627621|gb|EDV43145.1| GF16669 [Drosophila ananassae]
          Length = 397

 Score =  165 bits (418), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 105/294 (35%), Positives = 156/294 (53%), Gaps = 12/294 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           +A  PY  L R     G +L   PC WS  L+A     AG   W  +   L ++  GA++
Sbjct: 82  AAAKPYAQLMRIDRPIGTYLLFWPCAWSIALSA----DAGC--WPDLT-MLGLFGTGALI 134

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT NDL D DID++V RTR RPL SGQ ++F A+VF   Q  +  ++L+Q N   
Sbjct: 135 MRGAGCTINDLWDKDIDAKVERTRMRPLASGQISQFDAIVFLSAQLSLGLLVLVQLNWES 194

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTI 195
           I +G + L + + YP  KR    PQ+VLG+ F  G  +GW A   S +  A   L +  +
Sbjct: 195 ILLGASSLGLVITYPLMKRVTYWPQLVLGMAFNWGALLGWCATQGSVNLAACLPLYLSGV 254

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA--FCLLTV 253
            W + +DT+YAHQDK DD  IGV STA  F   TK+WL       +     +   C  T+
Sbjct: 255 CWTIVYDTIYAHQDKLDDLQIGVKSTALRFGENTKVWLSGFAAAMLTGLTASGLACDQTL 314

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
            ++A +G++ A    +++I +L+I     C   F S   VG+++ + +++   L
Sbjct: 315 PYYAAVGIVGAHL--VQQIYSLNIDNPSDCAKKFFSNHQVGLILFLGIVLGTLL 366


>gi|194903991|ref|XP_001980980.1| GG17457 [Drosophila erecta]
 gi|190652683|gb|EDV49938.1| GG17457 [Drosophila erecta]
          Length = 392

 Score =  165 bits (418), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 107/294 (36%), Positives = 155/294 (52%), Gaps = 12/294 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           SA  PY  L R     G +L   PC WS  L+A     AG   W  +   L ++  GA++
Sbjct: 75  SAAKPYAQLMRIDRPIGTYLLFWPCAWSIALSA----DAGC--WPDLT-MLGLFGTGALI 127

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT NDL D DID++V RT+ RPL SGQ ++F A+VF   Q  +  ++L+Q N   
Sbjct: 128 MRGAGCTINDLWDKDIDAKVERTKLRPLASGQISQFDAIVFLSAQLSLGLLVLVQLNWQS 187

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTI 195
           I +G + L + + YP  KR    PQ+VLG+ F  G  +GW A   S +  A   L +  +
Sbjct: 188 ILLGASSLGLVITYPLMKRVTYWPQLVLGMAFNWGALLGWCATQGSVNLAACLPLYLSGV 247

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA--FCLLTV 253
            W + +DT+YAHQDK DD  IGV STA  F   TK WL       +     A   C  TV
Sbjct: 248 CWTIVYDTIYAHQDKLDDLQIGVKSTALRFGDNTKAWLSGFTAAMLTGLSAAGWACDQTV 307

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
            ++A +G++ A    +++I +L+I     C   F S   VG+++ + +++   L
Sbjct: 308 PYYAAVGIVGAHL--VQQIYSLNIDNPSDCAKKFLSNHQVGLILFLGIVLGTLL 359


>gi|217979035|ref|YP_002363182.1| 4-hydroxybenzoate polyprenyl transferase [Methylocella silvestris
           BL2]
 gi|217504411|gb|ACK51820.1| 4-hydroxybenzoate polyprenyl transferase [Methylocella silvestris
           BL2]
          Length = 329

 Score =  165 bits (418), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 118/209 (56%), Gaps = 6/209 (2%)

Query: 20  APYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRG 79
           AP++ LAR     GW L VLPC  S+ LA+     A  LG       L ++++GAI  RG
Sbjct: 38  APFLQLARIDRPIGWQLLVLPCWQSSALASAHQGAAPRLG------DLALFLIGAIAMRG 91

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICV 139
           A  T+ND+VD DID++V RTR RP+P+G+ +   A  F   Q L+    LL FN F I +
Sbjct: 92  AGSTYNDIVDRDIDAKVERTRLRPIPAGRVSIAAAAAFLAAQCLVGLAALLSFNRFAIAL 151

Query: 140 GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVV 199
           GFA L    +YPF KR    PQ VLG  FA G  +GW A   S S     L  G I W +
Sbjct: 152 GFASLGFVAIYPFMKRVTSWPQAVLGAAFAWGALMGWAAAEGSLSLAPVLLYCGAIAWTI 211

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQ 228
            +DT+YA QD KDD +IG+ STAR F   
Sbjct: 212 GYDTIYALQDVKDDAIIGIGSTARFFGEH 240


>gi|170740485|ref|YP_001769140.1| 4-hydroxybenzoate polyprenyl transferase [Methylobacterium sp.
           4-46]
 gi|168194759|gb|ACA16706.1| 4-hydroxybenzoate polyprenyl transferase [Methylobacterium sp.
           4-46]
          Length = 326

 Score =  165 bits (417), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 152/296 (51%), Gaps = 6/296 (2%)

Query: 9   WVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLF 68
           WV D    +++ PY+ LAR     GW L +LPC WS  LAA    R G        W+L 
Sbjct: 30  WV-DRHAPASVRPYLRLARIERPIGWWLLLLPCWWSASLAAVATGRLG-----PNLWHLA 83

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           +++VGAI  RGA  T+ND+ D D+D++V RTR RPLPSG+     AL F V Q L+   +
Sbjct: 84  LFLVGAIAMRGAGSTYNDIADRDLDARVERTRLRPLPSGRLRVRHALAFLVAQALVGLAV 143

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           LLQFN F I VG   L     YPF KR +  PQ+VLG+ FA G  +GW  L         
Sbjct: 144 LLQFNAFAIGVGLVSLVPVAFYPFMKRVMPVPQLVLGLAFAWGALMGWAGLVGRLDPAPL 203

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAF 248
           +L  G I WV+ +DT+YA QD +DDE+ G+ S+AR F    +  +   +   V C  VA 
Sbjct: 204 WLYAGAIAWVIGYDTIYAVQDIEDDEIAGIKSSARFFGTHVRAAVAACFAGAVACIGVAA 263

Query: 249 CLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
               V    ++GL++       ++  LD          F S    G+++   L + 
Sbjct: 264 AQSGVGPLGFLGLVLFAGHLAWQVHRLDPRDGALALRLFRSNRDAGLILFAGLTLD 319


>gi|114570792|ref|YP_757472.1| 4-hydroxybenzoate octaprenyltransferase [Maricaulis maris MCS10]
 gi|114341254|gb|ABI66534.1| 4-hydroxybenzoate octaprenyltransferase [Maricaulis maris MCS10]
          Length = 308

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 146/287 (50%), Gaps = 9/287 (3%)

Query: 18  AIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVT 77
           A+ PY+ LAR+    G+ L  LPC    +LA     R G        W  F++ +GAI  
Sbjct: 24  ALRPYLRLARYDRPIGFWLLALPCWMGLMLA-----RIGDGIAPYDIWLAFLFAIGAIAM 78

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           RGA CT+ND++D ++D++V RT  RPL +G  +  QA  F   Q L+  ++L+Q     I
Sbjct: 79  RGAGCTYNDIIDRELDARVARTAERPLAAGTVSLKQAWAFLSGQALVGLIVLVQLPLIAI 138

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFW 197
            VG   L +   YPF KR    PQ  LG+ F  G+ V + A           L +  +FW
Sbjct: 139 LVGLTALLLVAAYPFMKRITWWPQAWLGLTFNWGIPVAYTAATGRIDAAMIVLYVAAVFW 198

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFA 257
            + +DT+YAHQD +DD L+GV STARLF   ++ W+   YG   +  +VA  +       
Sbjct: 199 TLGYDTIYAHQDAEDDALVGVKSTARLFGENSQFWVAGFYGANAI--LVALVIWLSRAEP 256

Query: 258 WIGLLIALFLT--IKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           WI +   L+      ++  LDIS   +C   F +    G+L++  L+
Sbjct: 257 WIVIPFTLYTAHLFNQVRRLDISDGPRCLDLFKANRTTGLLLVATLL 303


>gi|195553031|ref|XP_002076590.1| GD15120 [Drosophila simulans]
 gi|194202201|gb|EDX15777.1| GD15120 [Drosophila simulans]
          Length = 392

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 155/294 (52%), Gaps = 12/294 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S   PY  L R     G +L   PC WS  L+A     AG   W  +   L ++  GA++
Sbjct: 75  SGAKPYAQLMRIDRPIGTYLLFWPCAWSIALSA----DAGC--WPDLT-MLGLFGTGALI 127

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT NDL D DID++V RTR RPL SGQ ++F A+VF   Q  +  ++L+Q N   
Sbjct: 128 MRGAGCTINDLWDKDIDAKVERTRLRPLASGQISQFDAIVFLSAQLSLGLLVLVQLNWQS 187

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTI 195
           I +G + L + + YP  KR    PQ+VLG+ F  G  +GW A   S +  A   L +  +
Sbjct: 188 ILLGASSLGLVITYPLMKRVTYWPQLVLGMAFNWGALLGWCATQGSVNLAACLPLYLSGV 247

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA--FCLLTV 253
            W + +DT+YAHQDK DD  IGV STA  F   TK+WL       +     A   C  T+
Sbjct: 248 CWTIVYDTIYAHQDKLDDLQIGVKSTALRFGENTKVWLSGFTAAMLTGLSAAGWACDQTL 307

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
            ++A +G++ A    +++I +L+I     C   F S   VG+++ + +++   L
Sbjct: 308 PYYAAVGVVGAHL--VQQIYSLNIDNPSDCAKKFISNHQVGLILFLGIVLGTLL 359


>gi|328868936|gb|EGG17314.1| 4-hydroxybenzoate nonaprenyltransferase [Dictyostelium
           fasciculatum]
          Length = 459

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 98/298 (32%), Positives = 150/298 (50%), Gaps = 10/298 (3%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
           +W+    +  +I PY++L+R     G  L + PCLWST LAA P       G       +
Sbjct: 152 EWISK--LPKSIQPYIFLSRLDKPIGTLLLLYPCLWSTALAADP-------GHLPDLKLM 202

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
            ++  GA + R A C  ND+ D+  D +V RT+ RPL S   +  QA      Q L SF 
Sbjct: 203 LMFTAGAFMMRSAGCVINDMADYKFDRKVERTKLRPLASSALSHRQAFALLSAQLLTSFG 262

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           +LL FN + I +  A + I ++YPF KRF   PQ VLG+ F  G  VG+ A+  S  W  
Sbjct: 263 ILLTFNNYTIILAMASVPIVIMYPFMKRFTYYPQFVLGLAFNWGALVGYSAVVGSCDWSV 322

Query: 188 FF-LCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV 246
              L +  I W + +DT+YAH DKKDD  +GV STA  F  ++++ L     + V   + 
Sbjct: 323 VLPLYLAGISWTMVYDTIYAHMDKKDDVSVGVKSTALAFGDRSRVILSAFSALTVAAMLA 382

Query: 247 AFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
                ++    +IG  +       +++++D +  + C  FF S     +L L+ +II+
Sbjct: 383 TGYASSMPLEYYIGSAVCASHLAYQMLSVDFNSPQSCMKFFISNRTFALLFLLTIIIA 440


>gi|83309870|ref|YP_420134.1| 4-hydroxybenzoate polyprenyltransferase and related
           prenyltransferase [Magnetospirillum magneticum AMB-1]
 gi|82944711|dbj|BAE49575.1| 4-hydroxybenzoate polyprenyltransferase and related
           prenyltransferase [Magnetospirillum magneticum AMB-1]
          Length = 231

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 91/230 (39%), Positives = 118/230 (51%)

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           RGA CT+ND  D D D +V RT SRP+PSG  +  QAL F  LQ L   V+L+Q N F I
Sbjct: 2   RGAGCTFNDWADRDFDGKVARTASRPIPSGAVSPTQALAFLGLQLLTGLVVLMQLNNFAI 61

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFW 197
            VG A L +   YPF KR    PQ  LG+ F  G  +GW A+      PA  L     FW
Sbjct: 62  AVGIASLLLVFPYPFMKRITYWPQAWLGLTFNWGALLGWAAVSGHMGLPALLLYAAGPFW 121

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFA 257
            + +DT+YAHQDK+DD LIGV STA      T  WL++ Y   +     A     + +  
Sbjct: 122 TLGYDTIYAHQDKEDDALIGVKSTALRLGDSTVTWLWLFYPATLALIGAAGWSAGLGWAF 181

Query: 258 WIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
           W GL +A    + +I  +DI     C + F S    G L+L  ++    L
Sbjct: 182 WPGLALAGGHLLWQIRKVDIHDGADCLAKFKSNRHFGWLVLAAIVAGKVL 231


>gi|196005433|ref|XP_002112583.1| hypothetical protein TRIADDRAFT_25833 [Trichoplax adhaerens]
 gi|190584624|gb|EDV24693.1| hypothetical protein TRIADDRAFT_25833 [Trichoplax adhaerens]
          Length = 318

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 103/285 (36%), Positives = 145/285 (50%), Gaps = 12/285 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L R+    G +L  LPC WS  +AA P       G       L ++ +GA+V RGA
Sbjct: 26  PYLRLIRFDRPIGTYLLYLPCTWSISMAATP-------GHLPDLKTLAVFGIGALVMRGA 78

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT ND+ D D D +V RTR RP+ SG     QAL F   Q  +   +LL  N + I +G
Sbjct: 79  GCTINDMWDSDFDKKVFRTRDRPIASGTIAHKQALGFLAAQLTVGLSILLSLNQYSIILG 138

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTIFWVV 199
              +   ++YP  KRF   PQ+ LGI F  G  +G+ A++    W     L   +I W +
Sbjct: 139 ACSVPFVIVYPLMKRFTFWPQLFLGITFNWGALLGYAAVNGYCDWNVVIPLYAASISWTL 198

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA--FCLLTVNFFA 257
           ++DT+YAHQDK DD  I V STA LF   TK WL +  GI     +++      T  +FA
Sbjct: 199 FYDTIYAHQDKDDDRFINVKSTALLFGDNTKHWLSLFAGITTTGLVLSGLSAHQTWPYFA 258

Query: 258 WIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
            +G   A  L   +I +++IS +  C   F S    G++I   +I
Sbjct: 259 AVGGGFAHLL--YQIYSVNISNTDSCLKVFKSNMWYGLIIFTGII 301


>gi|112984196|ref|NP_001037720.1| 4-hydroxybenzoate polyprenyltransferase, mitochondrial precursor
           [Rattus norvegicus]
 gi|90111986|sp|Q499N4|COQ2_RAT RecName: Full=4-hydroxybenzoate polyprenyltransferase,
           mitochondrial; AltName:
           Full=Para-hydroxybenzoate--polyprenyltransferase;
           Short=PHB:polyprenyltransferase; Flags: Precursor
 gi|71681105|gb|AAH99827.1| Coenzyme Q2 homolog, prenyltransferase (yeast) [Rattus norvegicus]
          Length = 374

 Score =  162 bits (409), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 156/296 (52%), Gaps = 15/296 (5%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GAI+ R
Sbjct: 71  LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAADP-------GCFPDWYMLSLFGTGAILMR 123

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT +RP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 124 GAGCTINDMWDRDFDKKVERTANRPIAAGDISAFQSFVFLGAQLTLALGVLLHLNYYSIA 183

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G A L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   PA  L +    + 
Sbjct: 184 MGAASLLLVVTYPLMKRVTFWPQLALGLTFNWGALLGWSAVKGSCD-PAVCLPLYFSGVM 242

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVN 254
           W + +DT+YAHQDKKDD LIG+ STA LF   TK WL  F +  +  L  + A    T+ 
Sbjct: 243 WTLIYDTIYAHQDKKDDALIGLKSTALLFRENTKQWLSGFGVAMVGALSLVGASSGQTLP 302

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLII-SLFLDQ 309
           ++A +           +I  +DI  ++ C   F S   VG+L+ + +++ +L+ D+
Sbjct: 303 YYAAV--AAVGAHLAHQIYTVDIHRAEDCWEKFTSNRTVGLLLFLGIVLGNLYKDK 356


>gi|149046787|gb|EDL99561.1| similar to 2310002F18Rik protein, isoform CRA_c [Rattus norvegicus]
          Length = 374

 Score =  162 bits (409), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 156/296 (52%), Gaps = 15/296 (5%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GAI+ R
Sbjct: 71  LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAADP-------GCFPDWYMLSLFGTGAILMR 123

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT +RP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 124 GAGCTINDMWDRDFDKKVERTANRPIAAGDISAFQSFVFLGAQLTLALGVLLHLNYYSIA 183

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G A L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   PA  L +    + 
Sbjct: 184 MGAASLLLVVTYPLMKRVTFWPQLALGLTFNWGALLGWSAVKGSCD-PAVCLPLYFSGVM 242

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVN 254
           W + +DT+YAHQDKKDD LIG+ STA LF   TK WL  F +  +  L  + A    T+ 
Sbjct: 243 WTLIYDTIYAHQDKKDDALIGLKSTALLFRENTKQWLSGFGVAMVGALSLVGASSGQTLP 302

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLII-SLFLDQ 309
           ++A +           +I  +DI  ++ C   F S   VG+L+ + +++ +L+ D+
Sbjct: 303 YYAAV--AAVGAHLAHQIYTVDIHRAEDCWEKFTSNRTVGLLLFLGIVLGNLYKDK 356


>gi|156408051|ref|XP_001641670.1| predicted protein [Nematostella vectensis]
 gi|156228810|gb|EDO49607.1| predicted protein [Nematostella vectensis]
          Length = 357

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 102/297 (34%), Positives = 143/297 (48%), Gaps = 14/297 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
            AI PY+ LAR     G  L  LPC WS  +AA P    GV         + ++ +GA++
Sbjct: 54  KAIQPYLKLARIDRPIGTWLLYLPCTWSIAMAAPP----GVF---PDMKMMALFGLGAVI 106

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT ND+ D   D +V RT  RPLPSG+ +  QAL F  +Q      +LL  N + 
Sbjct: 107 MRGAGCTINDMWDCKYDKKVTRTLCRPLPSGEVSHLQALGFLAVQLSAGLAVLLSLNTYS 166

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW----PAFFLCI 192
           I +G A L   ++YP  KR    P + LGI    G  +GW A+  S  W    P +  C+
Sbjct: 167 ILLGVASLGPVIVYPLMKRITYWPHIFLGITLNWGAMLGWSAIQGSCDWSVCLPLYLACV 226

Query: 193 GTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLT 252
               W + +DT+Y+HQDK DD  +GV S A L   Q K WL     I +    +A     
Sbjct: 227 P---WTIIYDTIYSHQDKSDDLAVGVKSAALLLGDQVKYWLSAFGAIMMTNMTIAGMACD 283

Query: 253 VNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQ 309
             +  +  L +A      +I  +D+S  + C   F S   +G+LIL  +I    L +
Sbjct: 284 QTWPYYTSLALAAAHLTWQIKTVDLSNDEDCFEKFKSNKWLGLLILTGIIGGGLLKE 340


>gi|156408053|ref|XP_001641671.1| predicted protein [Nematostella vectensis]
 gi|156228811|gb|EDO49608.1| predicted protein [Nematostella vectensis]
          Length = 298

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 100/287 (34%), Positives = 147/287 (51%), Gaps = 8/287 (2%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
            A+ PY+ LAR+    G  L  LPC WS  +AA P    GV     +   + ++ +GA++
Sbjct: 11  KAVQPYLKLARFDKPIGTWLLYLPCTWSIAMAAPP----GVFPDVKM---MALFGLGAVI 63

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT ND+ D D D +V RT SRPL +G    FQALVF   Q      +LL  N + 
Sbjct: 64  MRGAGCTINDMWDSDYDKKVSRTISRPLAAGHINHFQALVFLGAQLSAGLAVLLSLNVYS 123

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTI 195
           I +G A + + ++YP  KR    PQ+ LG+ F  G  +GW A+  S  W     L +  +
Sbjct: 124 IFLGAASVGLVIVYPLMKRITYWPQLFLGLTFNYGALLGWSAIQGSCDWSVCLPLYLAGV 183

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT+Y+ QD+ DD  IGV STA L   +TK WL     I +    +A       +
Sbjct: 184 PWTLVYDTIYSFQDRDDDRAIGVKSTALLLGDKTKYWLLAFGAIMMTNMTIAGMACDQTW 243

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
             +  L +A      +I  +++S ++ C   F S   +G+LIL  +I
Sbjct: 244 PYYTSLALAAAHLTWQIKTVNLSNTEDCFEKFKSNKWLGLLILTGII 290


>gi|157128875|ref|XP_001661527.1| 4-hydroxybenzoate octaprenyltransferase [Aedes aegypti]
 gi|122116948|sp|Q16QL3|COQ2_AEDAE RecName: Full=4-hydroxybenzoate polyprenyltransferase,
           mitochondrial; AltName: Full=Coenzyme Q biosynthesis
           protein 2; AltName:
           Full=Para-hydroxybenzoate--polyprenyltransferase;
           Short=PHB:polyprenyltransferase; Flags: Precursor
 gi|108872455|gb|EAT36680.1| 4-hydroxybenzoate octaprenyltransferase [Aedes aegypti]
          Length = 441

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 104/295 (35%), Positives = 153/295 (51%), Gaps = 16/295 (5%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L   PC WS  L+A     AG   W  + W L ++  GA + RGA
Sbjct: 118 PYARLMRIDRPIGSWLLFWPCGWSIALSA----PAGC--WPDL-WTLTLFGAGAFIMRGA 170

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT ND+ D DID +V RTR+RPL +G+ T   A  F   Q  +  ++LL+ N + I +G
Sbjct: 171 GCTINDMWDRDIDGKVARTRNRPLVAGELTSADAWFFLGAQLGVGLLILLELNWYSIVLG 230

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTIFWVV 199
            + L + ++YP  KR    PQ+VLG+ F  G  +GW A   S  W A   L +  + W +
Sbjct: 231 ASSLGLVIIYPLMKRITHWPQLVLGMTFNWGALLGWSATQGSVMWSACLPLYVAGVCWTI 290

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL----FILYGIFVLCFMVAFCLLTVNF 255
            +DT+YAHQDK DD L+G+ STA  F   TKLWL      + G  V   MV  C  T  +
Sbjct: 291 VYDTIYAHQDKVDDALLGIKSTAIRFGDNTKLWLSGFSTAMIGGLVASGMV--CEQTWPY 348

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
           ++ +G++ A      +I +L+I     C + F S   VG+++ + +++      +
Sbjct: 349 YSAVGVISAHL--AHQIYSLNIDNPTDCATKFISNHQVGLILFLGIVLGTLYKGY 401


>gi|163794887|ref|ZP_02188856.1| 4-hydroxybenzoate polyprenyl transferase [alpha proteobacterium
           BAL199]
 gi|159179706|gb|EDP64233.1| 4-hydroxybenzoate polyprenyl transferase [alpha proteobacterium
           BAL199]
          Length = 303

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 102/302 (33%), Positives = 149/302 (49%), Gaps = 5/302 (1%)

Query: 2   SQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWS 61
           S      WV D  +     PY  LAR     G  L  LPCLW   L     R    L  +
Sbjct: 5   SDIRQGDWV-DRYLPDGWGPYARLARLDRPIGTWLLYLPCLWGLALGWQATR----LSVA 59

Query: 62  TIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQ 121
            + W   ++ +GA+V RGA CT ND+ D D+D +V RT +RP+ SG  T  QAL+F   Q
Sbjct: 60  EMLWLAALFGIGALVMRGAGCTVNDMFDRDLDRRVARTATRPIASGVITPRQALLFLGAQ 119

Query: 122 FLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHA 181
             +   +LLQ N F   VG A+L +  +YP +KR    PQ VLG+ F  G  +G+ A+  
Sbjct: 120 LAVGLAILLQLNRFSWAVGVAVLVLVFVYPLAKRVTDWPQAVLGLTFNWGALLGYAAVTG 179

Query: 182 SFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFV 241
             + PA        FW + +DT+YAHQDK+DD ++GV S+A     +TK  L   Y + V
Sbjct: 180 ELAVPAMIAYAAGFFWTLGYDTIYAHQDKEDDAIVGVRSSALALGERTKPALVGFYAVTV 239

Query: 242 LCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICL 301
               VA     +  +++ GL         ++  +DI   + C S F +    G++I +  
Sbjct: 240 ALLGVAAWTAGLGPWSYAGLAAVAGHFAWQVRTVDIDDPQGCLSVFKANRDAGLIIALAF 299

Query: 302 II 303
           ++
Sbjct: 300 VL 301


>gi|114052597|ref|NP_001039358.1| 4-hydroxybenzoate polyprenyltransferase, mitochondrial precursor
           [Bos taurus]
 gi|118572244|sp|Q2KIQ4|COQ2_BOVIN RecName: Full=4-hydroxybenzoate polyprenyltransferase,
           mitochondrial; AltName:
           Full=Para-hydroxybenzoate--polyprenyltransferase;
           Short=PHB:polyprenyltransferase; Flags: Precursor
 gi|86826539|gb|AAI12552.1| Coenzyme Q2 homolog, prenyltransferase (yeast) [Bos taurus]
          Length = 371

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 106/293 (36%), Positives = 150/293 (51%), Gaps = 20/293 (6%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLF-IYIVGAIVT 77
           + PY+ L R     G  L  LPC WS  LAA P    G L      WY+  ++  GA++ 
Sbjct: 71  LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAADP----GCL----PDWYMLSLFGTGAVLM 122

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           RGA CT ND+ D D D +V RT SRP+ +G  + F++ VF   Q  ++  +LL  N + I
Sbjct: 123 RGAGCTINDMWDRDYDKKVTRTASRPIAAGDISTFRSFVFLGGQLTLALGVLLCLNYYSI 182

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTI 195
            +G A L +   YP  KR    PQ+ LG+ F  G  +GW A+  S   P+  L +    I
Sbjct: 183 ALGAASLLLVTTYPLMKRITYWPQLALGLTFNWGALLGWSAVKGSCD-PSVCLPLYFSGI 241

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT+YAHQDKKDD LIG+ STA LF   TK WL      F +  + A  L+ VN 
Sbjct: 242 MWTLIYDTIYAHQDKKDDALIGLKSTALLFREDTKKWL----SGFSVAMLGALSLVGVNS 297

Query: 256 FAWIGLLIALFLT----IKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
              +    AL         +I  LDI+  + C   F S   +G++I + +++ 
Sbjct: 298 GQTMPYYTALAAVGAHLAHQIYTLDINRPEDCWEKFTSNRTIGLIIFLGIVLG 350


>gi|224081375|ref|XP_002306388.1| predicted protein [Populus trichocarpa]
 gi|222855837|gb|EEE93384.1| predicted protein [Populus trichocarpa]
          Length = 294

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 107/295 (36%), Positives = 145/295 (49%), Gaps = 24/295 (8%)

Query: 12  DCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYI 71
           D  +   + PY +LAR     G  L   PC+WS  LAA P       G    F  + ++ 
Sbjct: 4   DVYLPRQVRPYAHLARLDKPIGTWLLAWPCMWSISLAAEP-------GSVPNFKMMALFG 56

Query: 72  VGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQ 131
            GA++ RGA CT NDL+D DID++V RT+ RP+ SG  T FQ L F   Q  +   +LLQ
Sbjct: 57  CGALLLRGAGCTINDLLDRDIDTKVERTKLRPVASGLLTPFQGLCFLGFQLFLGLGILLQ 116

Query: 132 FNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLC 191
            N +   +G + L +   YP  KRF   PQ  LG+ F  G  +GW A+  S   PA  + 
Sbjct: 117 LNNYSRILGASSLLLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWSAVKGSLD-PAIVIP 175

Query: 192 I--GTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCF-MVAF 248
           +    +FW + +DT+YAHQDK+DD  +GV STA  F   TK W   + G    C   +A 
Sbjct: 176 LYASGVFWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDSTKEW---ITGFGTACISSLAL 232

Query: 249 CLLTVNFFAWIGLLIALFLTIK------RIIALDISCSKQCCSFFHSAGVVGILI 297
           C     F A IG     FL         +I  +D+SC   C   F S    G ++
Sbjct: 233 C----GFDADIGWSFYAFLAAASGQLAWQIWTVDLSCRADCNRKFVSNKWFGAVV 283


>gi|326918718|ref|XP_003205635.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase,
           mitochondrial-like [Meleagris gallopavo]
          Length = 310

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 104/282 (36%), Positives = 143/282 (50%), Gaps = 18/282 (6%)

Query: 29  HSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLV 88
           H   G  L  LPC WS  LAA P       G    +  L ++  GA++ RGA CT NDL 
Sbjct: 23  HCYVGTWLLYLPCTWSIGLAAEP-------GCLPDWHMLSLFGAGAVLMRGAGCTINDLW 75

Query: 89  DHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISL 148
           D D D QV RT  RPL +G+ + FQ+ VF   Q  ++  +LL  N + I +G A L + +
Sbjct: 76  DRDYDKQVARTAGRPLAAGEISTFQSFVFLGGQLSLALCVLLCLNYYSIILGAASLSLVV 135

Query: 149 LYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW----PAFFLCIGTIFWVVYFDTV 204
            YP  KR    PQ+VLG  F  G  +GW A+  S  W    P +F     + W + +DT+
Sbjct: 136 TYPLMKRITYWPQLVLGFTFNWGALLGWSAVQGSCDWSVCLPLYF---AGVMWTLVYDTI 192

Query: 205 YAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVNFFAWIGLL 262
           YAHQDK+DD +IGV STA  F   TK WL  F    +  LC     C  T  +++ +  +
Sbjct: 193 YAHQDKRDDIVIGVKSTALKFKEDTKQWLSGFSTAMVSGLCVAGMNCDQTFPYYSAVAAI 252

Query: 263 IALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            A      +I  LDI   + C   F S   VG+L+ I +++ 
Sbjct: 253 GAHL--AHQIYTLDIDKPEDCWKKFASNRTVGVLLFIGIVLG 292


>gi|225715310|gb|ACO13501.1| Para-hydroxybenzoate--polyprenyltransferase, mitochondrial
           precursor [Esox lucius]
          Length = 391

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 154/296 (52%), Gaps = 26/296 (8%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           + + PY+ L R+    G  L  LPC WS  LAA P       G       L ++  GA++
Sbjct: 91  APVQPYLRLMRFDKPIGTWLLYLPCTWSIGLAADP-------GCLPHLGMLTLFGTGALL 143

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT ND+ D D D +V RT +RPL +G+ ++ QAL F   Q  ++  +LL  N + 
Sbjct: 144 MRGAGCTINDMWDKDFDKKVARTATRPLAAGEISQMQALTFLGGQLSLALGVLLCLNYYS 203

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW----PAFFLCI 192
           I +G A L + + YP  KR    PQ+VLG+ F  G  +GW A+  S  W    P +F   
Sbjct: 204 IALGAASLSLVVTYPLMKRITYWPQLVLGLTFNWGALIGWSAVMGSCDWSVCLPLYF--- 260

Query: 193 GTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLT 252
             + W + +DT+YAHQDK DD  +GV STA  F  QTK WL      F +  M    L  
Sbjct: 261 SGVMWTLIYDTIYAHQDKDDDVRVGVKSTALRFQEQTKPWL----SGFSVAMMSGLVLAG 316

Query: 253 VN------FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           +N      ++A + L++A  L+  +I  LDI+  + C   F S   +G+L+ + ++
Sbjct: 317 LNAEQTLPYYATL-LIVASHLS-HQIYTLDINKPEDCWKKFVSNRNLGLLLFLGIV 370


>gi|209736824|gb|ACI69281.1| Para-hydroxybenzoate--polyprenyltransferase, mitochondrial
           precursor [Salmo salar]
          Length = 380

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 106/296 (35%), Positives = 154/296 (52%), Gaps = 26/296 (8%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           + + PY+ L R     G  L  LPC WS  LAA P       G       L ++  GA++
Sbjct: 85  APMQPYLRLMRLDKPIGTWLLYLPCTWSIGLAADP-------GCLPHLGMLTLFGTGALL 137

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT ND+ D D D +V RT +RP+ +G+ T+ QALVF   Q  ++  +LL  N + 
Sbjct: 138 MRGAGCTINDMWDKDFDKKVARTATRPIAAGEITQMQALVFLGGQLSLALGVLLCLNYYS 197

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW----PAFFLCI 192
           I +G A L + + YP  KR    PQ+VLG+ F  G  +GW A+  S  W    P +F   
Sbjct: 198 IALGAASLSLVVTYPLMKRITYWPQLVLGLTFNWGALLGWSAVIGSCEWSVCLPLYF--- 254

Query: 193 GTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLT 252
             + W + +DT+YAHQDK DD  +GV STA  F  QTK WL      F++  M    +  
Sbjct: 255 SGVMWTLIYDTIYAHQDKDDDIRVGVKSTALRFQEQTKPWL----SGFMVAMMSGLIVAG 310

Query: 253 VN------FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           VN      ++A +   +A+ LT  +I  LDI+  + C   F S   +G+L+ + ++
Sbjct: 311 VNAEQTLPYYATLS-TVAIHLT-HQIYTLDINKPEDCWKKFVSNRNLGLLLFLGIV 364


>gi|182679207|ref|YP_001833353.1| 4-hydroxybenzoate polyprenyl transferase [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182635090|gb|ACB95864.1| 4-hydroxybenzoate polyprenyl transferase [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 322

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 118/289 (40%), Positives = 159/289 (55%), Gaps = 15/289 (5%)

Query: 18  AIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGV-LGWSTIFWYLFIYIVGAIV 76
           A  PY+ LAR     GW L +LPC W + LA+     AGV L W+    +L ++++GAIV
Sbjct: 36  AAHPYLQLARLDRPVGWWLLLLPCWWGSALASL---AAGVPLHWA----HLLLFLIGAIV 88

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA  T+ND+VD ++D++V RTR RPLPSG+ +   A  F +LQ LI   +LL FN F 
Sbjct: 89  MRGAGSTFNDIVDREVDAKVERTRMRPLPSGRVSVLGAQGFFLLQSLIGLAVLLSFNLFT 148

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I +G + L    +YPF KR    PQ VLG  FA G+ +GW A   S S     L +G I 
Sbjct: 149 IVLGLSSLVFVAIYPFMKRVTSWPQAVLGCAFAWGILMGWAAAFGSLSLAPVQLYLGGIA 208

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVL----CFMVAFCLLT 252
           W + +DT+YA QD +DD   GV STARLF  + +L + +LYG+ +L       VA  L  
Sbjct: 209 WTIGYDTIYAIQDIRDDVKAGVKSTARLFGTRIRLCVGLLYGLTLLLSAGALWVAGALHG 268

Query: 253 VNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICL 301
           +    WIG  + L   +K I   D+    Q    F S    G+L  I L
Sbjct: 269 LALIGWIGFALHLGWQVKSI---DLENVGQALRLFRSNRDAGLLFFIGL 314


>gi|296486387|gb|DAA28500.1| para-hydroxybenzoate--polyprenyltransferase, mitochondrial
           precursor [Bos taurus]
          Length = 371

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 106/293 (36%), Positives = 149/293 (50%), Gaps = 20/293 (6%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLF-IYIVGAIVT 77
           + PY+ L R     G  L  LPC WS  LAA P    G L      WY+  ++  GA++ 
Sbjct: 71  LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAADP----GCL----PDWYMLSLFGTGAVLM 122

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           RGA CT ND+ D D D +V RT SRP+ +G  + F++ VF   Q  ++  +LL  N + I
Sbjct: 123 RGAGCTINDMWDRDYDKKVTRTASRPIAAGDISTFRSFVFLGGQLTLALGVLLCLNYYSI 182

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTI 195
            +G A L +   YP  KR    PQ+ LG+ F  G  +GW A+  S   P+  L +    I
Sbjct: 183 ALGAASLLLVTTYPLMKRITYWPQLALGLTFNWGALLGWSAVKGSCD-PSVCLPLYFSGI 241

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT+YAHQDKKDD LIG+ STA LF   TK WL      F +  + A  L+ VN 
Sbjct: 242 MWTLIYDTIYAHQDKKDDALIGLKSTALLFREDTKKWL----SGFSVAMLGALSLVGVNS 297

Query: 256 FAWIGLLIALFLT----IKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
              +    AL         +I  LDI   + C   F S   +G++I + +++ 
Sbjct: 298 GQTMPYYTALAAVGAHLAHQIYTLDIHRPEDCWEKFTSNRTIGLIIFLGIVLG 350


>gi|81890553|sp|Q66JT7|COQ2_MOUSE RecName: Full=4-hydroxybenzoate polyprenyltransferase,
           mitochondrial; AltName:
           Full=Para-hydroxybenzoate--polyprenyltransferase;
           Short=PHB:polyprenyltransferase; Flags: Precursor
 gi|51873875|gb|AAH80773.1| Coenzyme Q2 homolog, prenyltransferase (yeast) [Mus musculus]
          Length = 374

 Score =  158 bits (400), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 149/290 (51%), Gaps = 14/290 (4%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GAI+ R
Sbjct: 71  LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAADP-------GCFPDWYMLSLFGTGAILMR 123

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT +RP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 124 GAGCTINDMWDRDFDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIA 183

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G A L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   PA  L +    + 
Sbjct: 184 MGAASLLLVVTYPLMKRITFWPQLALGLTFNWGALLGWSAVKGSCD-PAVCLPLYFSGVM 242

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVN 254
           W + +DT+YAHQDKKDD LIG+ STA LF   T+ WL  F +  +  L    A    TV 
Sbjct: 243 WTLIYDTIYAHQDKKDDALIGLKSTALLFQENTRQWLSGFGVAMVAALSLAGANSGQTVP 302

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           ++    +         +I  +DI  ++ C   F S   VG+L+ + +++ 
Sbjct: 303 YY--AAVAAVGAHLAHQIYTVDIHRAEDCWDKFTSNRTVGMLLFLGIVLG 350


>gi|83591911|ref|YP_425663.1| 4-hydroxybenzoate octaprenyltransferase [Rhodospirillum rubrum ATCC
           11170]
 gi|83574825|gb|ABC21376.1| 4-hydroxybenzoate octaprenyltransferase [Rhodospirillum rubrum ATCC
           11170]
          Length = 307

 Score =  158 bits (400), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 108/294 (36%), Positives = 150/294 (51%), Gaps = 15/294 (5%)

Query: 12  DCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYI 71
           D +    I PY+ L R     G  L + PC WS  +AA         GW  ++    ++ 
Sbjct: 18  DRMAPGVIRPYLKLMRLDRPIGTWLLLFPCWWSQSMAAQ--------GWPDLW-LAALFA 68

Query: 72  VGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQ 131
            GA+V RGA CT+ND+VD D D+QV RT +RP+PSG  +R +A+VF   Q L+   +LL 
Sbjct: 69  AGALVMRGAGCTFNDIVDRDFDAQVARTAARPIPSGAVSRKKAVVFLGAQLLVGLAVLLS 128

Query: 132 FNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLC 191
            N F I +G A L +   YPF KR    PQ  LG+ F  G  +GW A+  S       L 
Sbjct: 129 LNGFSIWLGVASLILVFGYPFMKRITYWPQAWLGLTFTYGALMGWAAVRGSLDPAPLLLY 188

Query: 192 IGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAF--C 249
               FW +++DT+YAHQDK+DD L+GV S+A      T+  L +   + +     A    
Sbjct: 189 AACFFWTLHYDTIYAHQDKEDDLLVGVKSSALALGSNTRPALVVFSTLMMALVAAAGWQA 248

Query: 250 LLTVNFFAWIGLLIA-LFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
            L+  F+A +GL  A L   I R+   DI  S  C   F S   VG L+L  ++
Sbjct: 249 GLSWPFWALLGLPAAHLAWQIWRV---DIHDSPVCLMIFKSNRFVGWLLLAAIV 299


>gi|291401512|ref|XP_002717029.1| PREDICTED: para-hydroxybenzoate-polyprenyltransferase,
           mitochondrial [Oryctolagus cuniculus]
          Length = 371

 Score =  158 bits (400), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 151/291 (51%), Gaps = 16/291 (5%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GA++ R
Sbjct: 71  LQPYLRLMRLDKPIGTWLLYLPCTWSISLAAEP-------GCFPDWYLLSLFGTGAVLMR 123

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT +RP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 124 GAGCTINDMWDQDYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIA 183

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G A L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   P+  L +    + 
Sbjct: 184 LGAASLLLVITYPLMKRITYWPQLALGLTFNWGALLGWSAVQGSCD-PSVCLPLYFSGVM 242

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVN 254
           W + +DT+YAHQDK+DD L+G+ STA  F   TK WL  F +  +  L      C  T  
Sbjct: 243 WTLIYDTIYAHQDKRDDALLGLKSTALRFRENTKQWLSGFGVAMLGALSLAGVSCDQTAP 302

Query: 255 FFAWIGLLIALFLTI-KRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           ++A    L+A+   +  +I  LDI   + C   F S   VG+LI + +++ 
Sbjct: 303 YYA---ALVAVGAHLAHQIYTLDIHRPEDCWDKFTSNRTVGLLIFVGIVLG 350


>gi|148688340|gb|EDL20287.1| coenzyme Q2 homolog, prenyltransferase (yeast), isoform CRA_c [Mus
           musculus]
          Length = 374

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 149/290 (51%), Gaps = 14/290 (4%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GAI+ R
Sbjct: 71  LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAADP-------GCFPDWYMLSLFGTGAILMR 123

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT +RP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 124 GAGCTINDMWDRDFDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIA 183

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G A L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   PA  L +    + 
Sbjct: 184 MGAASLLLVVTYPLVKRITFWPQLALGLTFNWGALLGWSAVKGSCD-PAVCLPLYFSGVM 242

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVN 254
           W + +DT+YAHQDKKDD LIG+ STA LF   T+ WL  F +  +  L    A    TV 
Sbjct: 243 WTLIYDTIYAHQDKKDDALIGLKSTALLFQENTRQWLSGFGVAMVAALSLAGANSGQTVP 302

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           ++    +         +I  +DI  ++ C   F S   VG+L+ + +++ 
Sbjct: 303 YY--AAVAAVGAHLAHQIYTVDIHRAEDCWDKFTSNRTVGMLLFLGIVLG 350


>gi|58584792|ref|YP_198365.1| prenyltransferase [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
 gi|58419108|gb|AAW71123.1| 4-hydroxybenzoate polyprenyltransferase [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 288

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 150/288 (52%), Gaps = 11/288 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R HS TG  L + P L   VLA+  L       W T F  L ++ +GA + R A 
Sbjct: 6   YFSLMRLHSLTGLWLVLFPGLSGIVLASTSL------SWQT-FLLLILFTIGAFLMRPAG 58

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND+ D  ID+ V RT+ RPL SG+    QAL+   L   I+ V+LL  N   + +G 
Sbjct: 59  CIINDIFDRKIDAHVERTKYRPLASGKLNVKQALILLFLLLSIALVVLLFTNKTTLILGV 118

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + +  +YP  KR++  PQ+ LG  F  G  +GW A+    S       IG IFW + +
Sbjct: 119 ISMCMVTIYPLLKRYVWWPQLFLGFTFNMGSLIGWAAVKNQISIEPMLFYIGCIFWTLSY 178

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           D +YAHQDKKDDE +G+ STA  F  +TK WL   Y I ++ ++ A  L ++N   +I L
Sbjct: 179 DPIYAHQDKKDDEKLGIKSTALYFGDKTKSWLKRFYLISLMVWLYAGILSSLNNIFYIAL 238

Query: 262 LIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQ 309
           L   F+  ++    +   S QC S F +   +G+L    L   +FLD+
Sbjct: 239 LAVGFIFYRQYKHFNPDNSSQCMSIFKNNSYIGLL----LFFGIFLDR 282


>gi|328721405|ref|XP_001950839.2| PREDICTED: 4-hydroxybenzoate polyprenyltransferase,
           mitochondrial-like [Acyrthosiphon pisum]
          Length = 375

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 150/293 (51%), Gaps = 8/293 (2%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S I PY+ L R+   TGW L   PC WS  LA+     AG L     F  L ++ +GA++
Sbjct: 75  STIKPYLELMRFSRPTGWLLLYWPCTWSIALAS----TAGEL---PNFEMLGLFGLGAVM 127

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT ND+ D DID +V RT++RPL     + F A VF   Q  +S ++LLQ N + 
Sbjct: 128 MRGAGCTINDMWDKDIDKKVERTKNRPLVVKSLSMFDAWVFLAGQLGLSLIVLLQLNLYT 187

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTI 195
           I VG + L +  LYP  KR    PQ VLG+ F  G  +GW A+H+S  + A   L    +
Sbjct: 188 IVVGASSLVLVTLYPLMKRITYWPQFVLGLTFNWGALLGWAAIHSSIDFTACLPLYAAGV 247

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W +++DT+Y  QD+KDD    + STA LF  ++K WL     + +   +         +
Sbjct: 248 AWTLFYDTIYGLQDRKDDNKHDIYSTAVLFGSKSKFWLTSFATMSLSSLITCGVNTGQTW 307

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLD 308
             ++ +  A      ++  LDI   + C + F S   +G ++ + + +S  L 
Sbjct: 308 PYYLAVGAAGAHMFNQVRTLDIYNPEDCGNKFVSNNHIGWIMFLGIALSTLLQ 360


>gi|167004227|ref|NP_082254.2| 4-hydroxybenzoate polyprenyltransferase, mitochondrial precursor
           [Mus musculus]
          Length = 374

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 149/290 (51%), Gaps = 14/290 (4%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GAI+ R
Sbjct: 71  LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAADP-------GCFPDWYMLSLFGTGAILMR 123

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT +RP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 124 GAGCTINDMWDRDFDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIA 183

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G A L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   PA  L +    + 
Sbjct: 184 MGAASLLLVVTYPLVKRITFWPQLALGLTFNWGALLGWSAVKGSCD-PAVCLPLYFSGVM 242

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVN 254
           W + +DT+YAHQDKKDD LIG+ STA LF   T+ WL  F +  +  L    A    TV 
Sbjct: 243 WTLIYDTIYAHQDKKDDALIGLKSTALLFQENTRQWLSGFGVAMVAALSLAGANNGQTVP 302

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           ++    +         +I  +DI  ++ C   F S   VG+L+ + +++ 
Sbjct: 303 YY--AAVAAVGAHLAHQIYTVDIHRAEDCWDKFTSNRTVGMLLFLGIVLG 350


>gi|311262881|ref|XP_003129405.1| PREDICTED: para-hydroxybenzoate--polyprenyltransferase,
           mitochondrial-like, partial [Sus scrofa]
          Length = 358

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 146/292 (50%), Gaps = 18/292 (6%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    +  L ++  GA++ R
Sbjct: 58  LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEP-------GCFPDWCMLSLFGTGAVLMR 110

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT SRP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 111 GAGCTINDMWDQDYDKKVTRTASRPIAAGDISTFQSFVFLGAQLTLALGVLLCLNHYSIA 170

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G + L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   P+  L +    I 
Sbjct: 171 LGASSLLLVITYPLMKRITYWPQLALGLTFNWGALLGWSAIKGSCE-PSVCLPLYFSGIM 229

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
           W + +DT+YAHQDKKDD LIG+ STA  F   TK WL      F +  + A  L+ VN  
Sbjct: 230 WTLIYDTIYAHQDKKDDALIGLKSTALRFREDTKQWL----SGFSVAMLGALSLVGVNSD 285

Query: 257 AWIGLLIALFLT----IKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
                 IAL         ++  LDI   + C   F S   VG+++   +++ 
Sbjct: 286 QTAPYYIALAAVGAHLAHQVYTLDIHRPEDCWDKFTSNRTVGLMLFAGIVLG 337


>gi|297292589|ref|XP_002808454.1| PREDICTED: LOW QUALITY PROTEIN:
           para-hydroxybenzoate--polyprenyltransferase,
           mitochondrial-like [Macaca mulatta]
          Length = 421

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 102/294 (34%), Positives = 153/294 (52%), Gaps = 22/294 (7%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GAI+ R
Sbjct: 121 LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEP-------GCFPDWYMLSLFGTGAILMR 173

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT SRP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 174 GAGCTINDMWDQDYDKKVTRTASRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIA 233

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G   L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   P+  L +    + 
Sbjct: 234 LGAGSLLLVITYPLMKRITYWPQLALGLTFNWGALLGWSAIKGSCD-PSVCLPLYFSGVM 292

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN-- 254
           W + +DT+YAHQDK+DD LIG+ STA  F   TKLWL      F +  + A  L+ VN  
Sbjct: 293 WTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKLWL----SGFSVAMLGALSLVGVNSG 348

Query: 255 ----FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
               ++A +G + A      +I  +DI   + C + F S   +G+++ + +++ 
Sbjct: 349 QTAPYYAALGAVGAHL--THQIYTVDIHRPEDCWNKFISNRTLGLIVFLGIVLG 400


>gi|158292287|ref|XP_313812.4| AGAP004513-PA [Anopheles gambiae str. PEST]
 gi|157017365|gb|EAA09225.4| AGAP004513-PA [Anopheles gambiae str. PEST]
          Length = 390

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 110/294 (37%), Positives = 154/294 (52%), Gaps = 12/294 (4%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           I+PY  L R     G  L   PC WS  L+A     AG   W      L ++ VGA V R
Sbjct: 73  ISPYARLMRIDRPIGSWLLFWPCGWSIALSA----PAGC--WPDAM-MLGLFGVGAFVMR 125

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT NDL D DID++V RTR+RPL SG+   F A+VF   Q  +  ++LLQ N + I 
Sbjct: 126 GAGCTINDLWDRDIDAKVERTRNRPLVSGEIAPFDAVVFLAGQLGVGLLVLLQLNWYSIL 185

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTIFW 197
           +G + L + ++YP  KR    PQ++LG  F  G  +GW A   S  W A   L +  + W
Sbjct: 186 LGASSLGLVIVYPLMKRVTYWPQLMLGATFNWGALLGWSATQGSVEWSACLPLYVAGVCW 245

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA--FCLLTVNF 255
            + +DT+YAHQDK DD +IG+ STA  F  +TKLWL       +   + A   C  T  +
Sbjct: 246 TIVYDTIYAHQDKVDDLIIGIKSTALRFGDKTKLWLSGFTAAMIGNLLTAGLVCDQTWPY 305

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQ 309
           +  IGL+ A      +I +L+I   K C + F S   VG L+ + +++     +
Sbjct: 306 YTSIGLIGAHL--AHQIHSLNIHNPKDCATKFISNHQVGFLLFLGIVLGTLYKK 357


>gi|74001788|ref|XP_535634.2| PREDICTED: similar to para-hydroxybenzoate-polyprenyltransferase,
           mitochondrial isoform 1 [Canis familiaris]
          Length = 368

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 148/294 (50%), Gaps = 22/294 (7%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GA++ R
Sbjct: 69  LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEP-------GCFPDWYMLSLFGTGAVLMR 121

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V+RT +RP+ +G  + FQ+ +F   Q  ++  +LL  N + I 
Sbjct: 122 GAGCTINDMWDRDYDKKVIRTANRPIAAGDISTFQSFIFLGGQLTLALGILLCLNYYSIA 181

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFS----WPAFFLCIGT 194
           +G A L + + YP  KR    PQ+ LG+ F  G  +GW A+  S       P +F     
Sbjct: 182 LGAASLLLVITYPLMKRITYWPQLALGLTFNWGALLGWSAIKGSCDLSICLPLYF---SG 238

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
           I W + +DT+YAHQDK+DD LIG+ STA  F   TK WL      F +  + A  L+ VN
Sbjct: 239 IMWTLIYDTIYAHQDKRDDALIGLKSTALRFQENTKQWL----SGFGVAMLGALSLVGVN 294

Query: 255 FFAWIGLLIALFLT----IKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
                    AL         +I  LDI   + C   F S   +G+++L+ +++ 
Sbjct: 295 SGQTAPYYTALAAVGAHLAHQIYTLDIHRPEDCWDKFTSNRTLGLVVLLGIVLG 348


>gi|321461425|gb|EFX72457.1| hypothetical protein DAPPUDRAFT_59083 [Daphnia pulex]
          Length = 284

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 98/282 (34%), Positives = 140/282 (49%), Gaps = 12/282 (4%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYP--LRRAGVLGWSTIFWYLFIYIVGAIV 76
           + PY+ L R     G  L   PC WS  LAA P  L   G+L          + + G+ V
Sbjct: 1   MQPYLRLMRIDRPIGTWLLFWPCSWSVALAAAPGCLPDLGMLS---------LMLAGSFV 51

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT ND+ D  ID +V RT++RPL S Q T F AL+F   Q  +   +LLQ N + 
Sbjct: 52  MRGAGCTINDMWDQKIDRKVERTKNRPLASNQITPFNALIFLGAQLSVGLAILLQLNWYS 111

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP-AFFLCIGTI 195
           I +G + L + + YP  KR    PQ +LG+ F  G  VG+ A+     W     L    +
Sbjct: 112 ILLGASSLGLVISYPLMKRITYWPQFILGLTFNWGALVGYSAVQGHCDWSICLPLYAAGV 171

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT+YAHQDK DD ++GV STA  F   T  WL     + V  F VA      ++
Sbjct: 172 AWTLVYDTIYAHQDKHDDVIVGVKSTALRFGEATSKWLTGFSLMTVTGFTVAGISAEQSW 231

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
             ++ +L +    I+++  L+I   + C   F S   +G +I
Sbjct: 232 PFYVAVLASSAHLIRQVATLNIKDGENCAKLFKSNSSIGAVI 273


>gi|296533750|ref|ZP_06896297.1| 4-hydroxybenzoate polyprenyl transferase [Roseomonas cervicalis
           ATCC 49957]
 gi|296265926|gb|EFH12004.1| 4-hydroxybenzoate polyprenyl transferase [Roseomonas cervicalis
           ATCC 49957]
          Length = 311

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 102/282 (36%), Positives = 143/282 (50%), Gaps = 8/282 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L  LP LW+  +AA         GW T  W   ++ +G++V RGA
Sbjct: 34  PYALLMRLDRPIGSWLLFLPGLWAFAMAAP--------GWGTGLWLTLLFAIGSVVMRGA 85

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C  NDL D D+D QV RT  RPL SG     QAL F      I   +LLQ NPF   +G
Sbjct: 86  GCVVNDLWDRDLDRQVTRTAGRPLASGAVRPKQALAFLAALLAIGLAILLQLNPFCWLLG 145

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L    LYP +KR    PQ VLG+ F+    +G+ A       P   L      W++ 
Sbjct: 146 VVSLVPVALYPLAKRVTDFPQAVLGLTFSWAAPMGYAAATGQLDAPGLLLYAAAFLWILG 205

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQD++DD L+G+ STAR F+ +T+  L + YG  +   + A  +  + +  +  
Sbjct: 206 YDTIYAHQDREDDALVGIRSTARFFAERTRAALVVFYGGMLALLLAAGAMAGMGWLFYPA 265

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           LL A  L +++I ALDI     C + F S   VG+L+ +  +
Sbjct: 266 LLPAALLLVRQIRALDIHDPALCLALFRSNREVGLLVALAFL 307


>gi|328863764|gb|EGG12863.1| hypothetical protein MELLADRAFT_87175 [Melampsora larici-populina
           98AG31]
          Length = 408

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 110/287 (38%), Positives = 157/287 (54%), Gaps = 18/287 (6%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           I PY+ ++R  S  G  L  LPC  S  LA+  +    +L  S + + L I+ +GA V R
Sbjct: 99  IKPYLAISRIQSPIGSILLFLPCATSITLASTSI----LLPPSQLIYQLGIFGLGAFVMR 154

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT NDL D +IDS+V RT +RPLPSG  T  +A+ +  LQ  +   +L+Q NP+ I 
Sbjct: 155 GAGCTINDLWDRNIDSKVKRTENRPLPSGSITIPKAITWLGLQLTVGLGVLIQLNPYSIL 214

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP-AFFLCIGTIFW 197
           +G   L + ++YP  KR    PQ+VLG  F  G  +G  A+  +  W  A  L  G + W
Sbjct: 215 LGSCSLLLVVIYPLMKRITYWPQLVLGFAFNWGALLGSSAILGATDWKVALPLYFGHVAW 274

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFA 257
            + +DT+YAHQDK+ D  +GV STA LF   TKL   IL G F L  M++   L+  +F 
Sbjct: 275 TIIYDTIYAHQDKEFDLKVGVKSTAILFHKNTKL---ILTG-FSLT-MISLIGLS-GYFN 328

Query: 258 WIGL---LIALFLT----IKRIIALDISCSKQCCSFFHSAGVVGILI 297
            +GL   LI+ F +    +  I  L+I     C + F+ + + G LI
Sbjct: 329 EVGLWFYLISCFGSSLHLLNLIYKLNIHNPTSCLNAFNLSTLTGFLI 375


>gi|198412846|ref|XP_002130409.1| PREDICTED: similar to COenzyme Q (ubiquinone) biosynthesis family
           member (coq-2) [Ciona intestinalis]
          Length = 394

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 85/218 (38%), Positives = 122/218 (55%), Gaps = 8/218 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           ++I PY+ LAR     G  L  +PC +S  LAA P       G     +YL ++ +GA +
Sbjct: 65  NSIRPYLELARVDKPIGTLLLYIPCAYSICLAAPP-------GQLPSLYYLGLFGLGAFL 117

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA C  NDL D D+D +V RT++RP+ SG  +   A+    +Q  +S  +LL  NP  
Sbjct: 118 MRGAGCVINDLWDRDLDKRVERTKNRPIASGAVSEKNAIKLLAVQLSLSLGILLTLNPTC 177

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I +G   +   ++YP +KRF + PQ VLG+ F  G  +G+ A+  + +WP       + F
Sbjct: 178 IMIGCVAMLPVVVYPLAKRFTMFPQAVLGLTFNMGALMGYVAVTNTINWPVQLSLYASCF 237

Query: 197 -WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
            W +Y+DTVYA QD KDD   G+ STARLFS  T+  L
Sbjct: 238 LWTMYYDTVYAFQDVKDDVKAGIKSTARLFSRYTEEEL 275


>gi|301753323|ref|XP_002912533.1| PREDICTED: para-hydroxybenzoate--polyprenyltransferase,
           mitochondrial-like [Ailuropoda melanoleuca]
          Length = 434

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 149/292 (51%), Gaps = 18/292 (6%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GA++ R
Sbjct: 134 LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEP-------GCFPDWYMLSLFGTGAVLMR 186

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V+RT SRP+ SG  + F++ +F   Q  ++  +LL  N + I 
Sbjct: 187 GAGCTINDMWDRDYDKKVIRTASRPIASGDISIFRSFIFLGGQLTLALGVLLCLNYYSIA 246

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G A L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   P+  L +    I 
Sbjct: 247 LGAASLLLVITYPLMKRITYWPQLALGLTFNWGALLGWSAVKGSCD-PSVCLPLYFSGIM 305

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
           W + +DT+YAHQDK+DD LIG+ STA  F   TK WL      F +  + A  L+ VN  
Sbjct: 306 WTLIYDTIYAHQDKRDDALIGLKSTALRFRENTKQWL----SGFGVAMLGALSLVGVNSG 361

Query: 257 AWIGLLIALFLT----IKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
                  AL         +I  LDI   + C   F S   +G+++L+ +I+ 
Sbjct: 362 QTAPYYTALAAVGAHLAHQIYTLDIHRPEDCWDKFTSNRTLGLIVLLGIILG 413


>gi|296196127|ref|XP_002745711.1| PREDICTED: para-hydroxybenzoate--polyprenyltransferase,
           mitochondrial-like [Callithrix jacchus]
          Length = 390

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 155/294 (52%), Gaps = 22/294 (7%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GAI+ R
Sbjct: 90  LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEP-------GCFPDWYMLSLFGTGAILMR 142

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT +RP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 143 GAGCTINDMWDQDYDKKVARTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIV 202

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G + L + ++YP  KR    PQ+ LG+ F  G  +GW A+  S   P+  L +    + 
Sbjct: 203 LGASSLLLVIIYPLMKRITYWPQLALGLTFNWGALLGWSAIKGSCD-PSVCLPLYFSGVV 261

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN-- 254
           W + +DT+YAHQDK+DD LIG+ STA  F   TK WL     +F +  + A  L+ VN  
Sbjct: 262 WTLIYDTIYAHQDKRDDVLIGLKSTALHFGENTKQWL----SVFSVAMLGALSLVGVNSG 317

Query: 255 ----FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
               ++  +G + A    + +I  LDI   + C + F S   +G+++ + +++ 
Sbjct: 318 QTAPYYTALGAVGAHL--VHQIYTLDIHRPEDCWNKFISNRTLGLILFLGIVLG 369


>gi|288957598|ref|YP_003447939.1| 4-hydroxybenzoate octaprenyltransferase [Azospirillum sp. B510]
 gi|288909906|dbj|BAI71395.1| 4-hydroxybenzoate octaprenyltransferase [Azospirillum sp. B510]
          Length = 315

 Score =  155 bits (393), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 106/296 (35%), Positives = 150/296 (50%), Gaps = 24/296 (8%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLA-AYPLRRAGVLGWSTIFWYLFIYIVGAI 75
           + + PYV LAR     G  L + PC WS  LA   P R      W ++ W + ++ VGA+
Sbjct: 30  ARLRPYVTLARLDRPIGTWLLLFPCWWSLALAMPQPFR-----DWPSLLWLMALFGVGAV 84

Query: 76  VTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPF 135
           + RGA CT ND++D   D+ V RTRSRP+PSGQ +  QAL F   Q L+S ++LLQ    
Sbjct: 85  LMRGAGCTVNDILDRKFDAMVERTRSRPIPSGQVSVRQALAFLATQLLVSLLVLLQLGMT 144

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTI 195
            I +G   L +   YP  KR    PQ  LG+ F  G  +GW  + +   WPA  L +  I
Sbjct: 145 AIGLGVLSLLLVFTYPLMKRITWWPQAFLGLTFNWGALLGWATVRSDVGWPALALYVTGI 204

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT+YAHQDK+DD  IGV STA     Q+K+W   +YG + L +      + +  
Sbjct: 205 AWTLGYDTIYAHQDKEDDARIGVKSTALRLGDQSKIW---IYGFYTLTY------VGIGI 255

Query: 256 FAWIGLLIALFLTIKRIIALDIS---------CSKQCCSFFHSAGVVGILILICLI 302
              +  L  LFL +  + AL ++             C   F S    G L+L  ++
Sbjct: 256 AGRLAGLGGLFLPVLSLAALQLAWQVATWRPDDQGDCLEKFKSNRWFGWLVLAAIL 311


>gi|312380983|gb|EFR26840.1| hypothetical protein AND_06803 [Anopheles darlingi]
          Length = 484

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 89/229 (38%), Positives = 128/229 (55%), Gaps = 5/229 (2%)

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           RGA CT NDL D DID++V RT+ RPL +G+ + F ALVF   Q  +   +LLQ N + I
Sbjct: 2   RGAGCTINDLWDRDIDAKVERTKHRPLVAGEISPFDALVFLAAQLGVGLTVLLQLNWYSI 61

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTIF 196
            +G + L + ++YP  KR    PQ++LG  F  G  +GW A   S  W A   L    + 
Sbjct: 62  LLGASSLGLVIVYPLMKRITYWPQLMLGATFNWGALLGWSATQGSVDWAACLPLYAAGVC 121

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV--AFCLLTVN 254
           W + +DT+YAHQDK DD LIG+ STA  F   TKLWL    G  ++  M   A C  T  
Sbjct: 122 WTIVYDTIYAHQDKVDDLLIGIKSTALRFGDNTKLWLSGFTGAMMVNLMAAGAACDQTWP 181

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLII 303
           ++  +GL+ A     ++I +L+I     C + F S   VG+L+ + +++
Sbjct: 182 YYTSVGLIAAHL--AQQIHSLNIHNPTDCATKFISNHQVGLLLFLGIVL 228


>gi|114325407|gb|AAH20728.2| Coenzyme Q2 homolog, prenyltransferase (yeast) [Homo sapiens]
 gi|119626333|gb|EAX05928.1| coenzyme Q2 homolog, prenyltransferase (yeast), isoform CRA_b [Homo
           sapiens]
          Length = 384

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 152/294 (51%), Gaps = 22/294 (7%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GAI+ R
Sbjct: 84  LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEP-------GCFPDWYMLSLFGTGAILMR 136

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT +RP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 137 GAGCTINDMWDQDYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIA 196

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G   L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   P+  L +    + 
Sbjct: 197 LGAGSLLLVITYPLMKRISYWPQLALGLTFNWGALLGWSAIKGSCD-PSVCLPLYFSGVM 255

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN-- 254
           W + +DT+YAHQDK+DD LIG+ STA  F   TK WL      F +  + A  L+ VN  
Sbjct: 256 WTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWL----SGFSVAMLGALSLVGVNSG 311

Query: 255 ----FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
               ++A +G + A      +I  LDI   + C + F S   +G+++ + +++ 
Sbjct: 312 QTAPYYAALGAVGAHL--THQIYTLDIHRPEDCWNKFISNRTLGLIVFLGIVLG 363


>gi|281202156|gb|EFA76361.1| 4-hydroxybenzoate nonaprenyltransferase [Polysphondylium pallidum
           PN500]
          Length = 462

 Score =  155 bits (392), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 105/294 (35%), Positives = 149/294 (50%), Gaps = 12/294 (4%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L+R     G  L + PCLWST +AA P       G    F  + ++  GA + R
Sbjct: 137 LQPYLRLSRLDKPIGTLLLLYPCLWSTAIAATP-------GQLPNFTLMMMFGAGAFLMR 189

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
            A C  ND+VD+  D +V RT+ RP+ S Q T  +AL     Q  ISF LLL FN + I 
Sbjct: 190 SAGCVINDMVDYKFDRKVDRTKLRPIASNQVTHKEALALLAGQLAISFGLLLNFNVYTIL 249

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP-AFFLCIGTIFW 197
           +  A + I ++YPF KR+   PQ VLG  F  G  VG+ A+     W     L +  I W
Sbjct: 250 LSLASVPIVIIYPFMKRYTYYPQFVLGCAFNWGALVGYSAVQGYCDWKICLPLYVAGISW 309

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVNF 255
            + +DT+YAH DKKDD  IGV STA  F  +++L L  F +  I  L        L   +
Sbjct: 310 TMVYDTIYAHMDKKDDLSIGVKSTALAFGEKSRLILTGFSVATIAALNLAGLAAGLPTVY 369

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQ 309
           F  +G  I       +I ++D S  K C  FF S     ++IL+ +I++  ++ 
Sbjct: 370 F--VGTTIGAAHLAWQIGSVDFSSPKSCMKFFISNRTFALIILVTIILARLIED 421


>gi|74731901|sp|Q96H96|COQ2_HUMAN RecName: Full=4-hydroxybenzoate polyprenyltransferase,
           mitochondrial; AltName: Full=COQ2 homolog; Short=hCOQ2;
           AltName:
           Full=Para-hydroxybenzoate--polyprenyltransferase;
           Short=PHB:polyprenyltransferase; Flags: Precursor
 gi|14250676|gb|AAH08804.1| COQ2 protein [Homo sapiens]
 gi|123998505|gb|ABM86854.1| coenzyme Q2 homolog, prenyltransferase (yeast) [synthetic
           construct]
 gi|157929092|gb|ABW03831.1| coenzyme Q2 homolog, prenyltransferase (yeast) [synthetic
           construct]
          Length = 371

 Score =  155 bits (391), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 152/294 (51%), Gaps = 22/294 (7%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GAI+ R
Sbjct: 71  LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEP-------GCFPDWYMLSLFGTGAILMR 123

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT +RP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 124 GAGCTINDMWDQDYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIA 183

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G   L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   P+  L +    + 
Sbjct: 184 LGAGSLLLVITYPLMKRISYWPQLALGLTFNWGALLGWSAIKGSCD-PSVCLPLYFSGVM 242

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN-- 254
           W + +DT+YAHQDK+DD LIG+ STA  F   TK WL      F +  + A  L+ VN  
Sbjct: 243 WTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWL----SGFSVAMLGALSLVGVNSG 298

Query: 255 ----FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
               ++A +G + A      +I  LDI   + C + F S   +G+++ + +++ 
Sbjct: 299 QTAPYYAALGAVGAHL--THQIYTLDIHRPEDCWNKFISNRTLGLIVFLGIVLG 350


>gi|118361383|ref|XP_001013920.1| 4-hydroxybenzoate polyprenyl transferase family protein [Tetrahymena
            thermophila]
 gi|89295687|gb|EAR93675.1| 4-hydroxybenzoate polyprenyl transferase family protein [Tetrahymena
            thermophila SB210]
          Length = 1290

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 103/293 (35%), Positives = 149/293 (50%), Gaps = 25/293 (8%)

Query: 21   PYVYLARWHSSTGWHLAVLPCLWSTVLAA---YPLRRAGVLGWSTIFWYLFIYIVGAIVT 77
            PYV L R+    G+ L   PC+W   L      PL  A + G    F++      G+ V 
Sbjct: 978  PYVRLGRYEKPIGYKLLFWPCVWGAALGQPILSPLALAHLFG---TFYF------GSAVM 1028

Query: 78   RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
            R A C  ND+ D D D++V RT+ RPL SG  T  QA +F         + L Q N F I
Sbjct: 1029 RAAGCIVNDMWDRDFDNKVERTKVRPLASGDLTMKQASIFLFFHLCGGLLTLTQLNWFSI 1088

Query: 138  CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGA----LHASFSWPAFFLCIG 193
             + F ++ I+ LYP  KRF   PQVVLG  F  GV VG+ A    ++ + + PA+   IG
Sbjct: 1089 ALSFGIVPIAALYPLFKRFTYYPQVVLGSCFNWGVMVGYAAAADMINYNVAIPAY---IG 1145

Query: 194  TIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCL--L 251
             + W + +DT+YAHQDK DD  +GV STA  +   TK  ++ L+G  +  F+ A     L
Sbjct: 1146 GVLWTLIYDTIYAHQDKLDDIKVGVKSTALAWGENTKNVMYGLWGTQLSLFLYAGIQGGL 1205

Query: 252  TVNFFAWIGLLIALFLTIKRIIA-LDISCSKQCCSFFHSAGVVGILILICLII 303
             + FF      +A  L + R+I   ++   K C +FF      G+L+ + ++I
Sbjct: 1206 GLPFFP---CCLASHLYLFRLIQDFNMDDPKTCWNFFVYNKNFGLLMFLSILI 1255


>gi|83950614|ref|ZP_00959347.1| 4-hydroxybenzoate polyprenyl transferase [Roseovarius nubinhibens
           ISM]
 gi|83838513|gb|EAP77809.1| 4-hydroxybenzoate polyprenyl transferase [Roseovarius nubinhibens
           ISM]
          Length = 321

 Score =  155 bits (391), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 97/231 (41%), Positives = 126/231 (54%), Gaps = 4/231 (1%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L+R     G  L +LPC W  +LA   +   G  GW  + W      +GA V RGA 
Sbjct: 34  YLRLSRADRPIGTWLLLLPCWWGLLLA---MLHTGQAGWGDL-WLFVASAIGAFVMRGAG 89

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           CTWND+ D  ID  V RT SRP+PSGQ +   A V+  LQ L+  V+LL FN   I +G 
Sbjct: 90  CTWNDITDRHIDGSVARTASRPIPSGQVSLRGAFVWLGLQLLLGLVILLSFNSAAILMGV 149

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L    +YPF+KRF   PQV LGI F  G  + W A   S       L +  I W +++
Sbjct: 150 LSLGPVAIYPFAKRFTWWPQVFLGIAFNWGALMLWVAHVGSLGLAPVLLYLSGIAWTLFY 209

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLT 252
           DT+YAHQD +DD +IGV STARLF+ +T  WL     + V+  M A  + T
Sbjct: 210 DTIYAHQDAEDDAIIGVKSTARLFAERTPAWLARFLVVAVILMMAAVIVAT 260


>gi|114593901|ref|XP_526592.2| PREDICTED: para-hydroxybenzoate-polyprenyltransferase,
           mitochondrial isoform 2 [Pan troglodytes]
          Length = 421

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 152/294 (51%), Gaps = 22/294 (7%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GAI+ R
Sbjct: 121 LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEP-------GCFPDWYMLSLFGTGAILMR 173

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT +RP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 174 GAGCTINDMWDQDYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIA 233

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G   L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   P+  L +    + 
Sbjct: 234 LGAGSLLLVITYPLMKRISYWPQLALGLTFNWGALLGWSAIKGSCD-PSVCLPLYFSGVM 292

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN-- 254
           W + +DT+YAHQDK+DD LIG+ STA  F   TK WL      F +  + A  L+ VN  
Sbjct: 293 WTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWL----SGFSVAMLGALSLVGVNSG 348

Query: 255 ----FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
               ++A +G + A      +I  LDI   + C + F S   +G+++ + +++ 
Sbjct: 349 QTAPYYAALGAVGAHL--THQIYTLDIHRPEDCWNKFISNRTLGLIVFLGIVLG 400


>gi|23007811|ref|ZP_00049520.1| COG0382: 4-hydroxybenzoate polyprenyltransferase and related
           prenyltransferases [Magnetospirillum magnetotacticum
           MS-1]
          Length = 233

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 121/219 (55%)

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFA 142
           T  D+ D  +D+QV RTRSRPLPSGQ +   A +F V+Q L+   +LLQFN   I VG  
Sbjct: 5   TITDIADRKLDAQVERTRSRPLPSGQVSTKAAALFLVVQALVGLAVLLQFNATAILVGML 64

Query: 143 LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFD 202
            L    +YPF KR +  PQ VLG+ F+ G  +GW A+      PA +L  GT+ WVV +D
Sbjct: 65  SLVPVAVYPFMKRVMPIPQAVLGLAFSWGALMGWVAVFGRVDAPALWLYAGTVAWVVGYD 124

Query: 203 TVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLL 262
           T+YA QD +DDE++G++S+ARLF  + +L + + Y   V  F+ A          W+GL 
Sbjct: 125 TIYAVQDIEDDEIVGIHSSARLFGARLRLAVGLCYAATVTLFVPALIGAGAGPLGWLGLA 184

Query: 263 IALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICL 301
           +      +++  L      +  + F S    G+++   L
Sbjct: 185 LFAAHLARQVATLSERDGPRALALFRSNRNAGLILFAGL 223


>gi|51870555|emb|CAF18241.1| para-hydroxybenzoate--polyprenyltransferase, mitochondrial
           precursor [Homo sapiens]
          Length = 421

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 152/294 (51%), Gaps = 22/294 (7%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GAI+ R
Sbjct: 121 LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEP-------GCFPDWYMLSLFGTGAILMR 173

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT +RP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 174 GAGCTINDMWDQDYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIA 233

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G   L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   P+  L +    + 
Sbjct: 234 LGAGSLLLVITYPLMKRISYWPQLALGLTFNWGALLGWSAIKGSCD-PSVCLPLYFSGVM 292

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN-- 254
           W + +DT+YAHQDK+DD LIG+ STA  F   TK WL      F +  + A  L+ VN  
Sbjct: 293 WTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWL----SGFSVAMLGALSLVGVNSG 348

Query: 255 ----FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
               ++A +G + A      +I  LDI   + C + F S   +G+++ + +++ 
Sbjct: 349 QTAPYYAALGAVGAHL--THQIYTLDIHRPEDCWNKFISNRTLGLIVFLGIVLG 400


>gi|260656052|ref|NP_056512.5| 4-hydroxybenzoate polyprenyltransferase, mitochondrial [Homo
           sapiens]
          Length = 421

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 152/294 (51%), Gaps = 22/294 (7%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GAI+ R
Sbjct: 121 LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEP-------GCFPDWYMLSLFGTGAILMR 173

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT +RP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 174 GAGCTINDMWDQDYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIA 233

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G   L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   P+  L +    + 
Sbjct: 234 LGAGSLLLVITYPLMKRISYWPQLALGLTFNWGALLGWSAIKGSCD-PSVCLPLYFSGVM 292

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN-- 254
           W + +DT+YAHQDK+DD LIG+ STA  F   TK WL      F +  + A  L+ VN  
Sbjct: 293 WTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWL----SGFSVAMLGALSLVGVNSG 348

Query: 255 ----FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
               ++A +G + A      +I  LDI   + C + F S   +G+++ + +++ 
Sbjct: 349 QTAPYYAALGAVGAHL--THQIYTLDIHRPEDCWNKFISNRTLGLIVFLGIVLG 400


>gi|66813452|ref|XP_640905.1| 4-hydroxybenzoate nonaprenyltransferase [Dictyostelium discoideum
           AX4]
 gi|74855507|sp|Q54U71|COQ2_DICDI RecName: Full=4-hydroxybenzoate polyprenyltransferase,
           mitochondrial; AltName:
           Full=Para-hydroxybenzoate--polyprenyltransferase;
           Short=PHB:polyprenyltransferase; Flags: Precursor
 gi|60468917|gb|EAL66917.1| 4-hydroxybenzoate nonaprenyltransferase [Dictyostelium discoideum
           AX4]
          Length = 463

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/295 (33%), Positives = 151/295 (51%), Gaps = 9/295 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           +++ PY+ L+R     G  L + PC WS  LAA         G       + ++ +GA V
Sbjct: 166 NSVQPYLRLSRVDKPIGVWLLLYPCCWSISLAA-------PAGSFPDLKTMLVFGIGAYV 218

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQ-FNPF 135
            R A C  ND+ D+  DS+V RT++RP+ S Q T  Q+L+F   Q L SF L+L   N +
Sbjct: 219 MRSAGCVINDMADYKFDSKVERTKTRPIASKQLTHKQSLIFLGGQLLASFGLILSSLNYY 278

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGT 194
            I +  + L I +LYPF KRF   PQ VLG+ F  G   G+ A+  S +W     L +  
Sbjct: 279 TIALCASSLPIVVLYPFMKRFTYYPQFVLGLAFNWGALAGYSAIAGSCNWSIVAPLYLAG 338

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
           I W + +DT+YAHQDK+DD L+GV STA  F+ ++++ L +  G+ +    +      + 
Sbjct: 339 ISWTMVYDTIYAHQDKRDDILVGVKSTALKFAEKSRIILSVFSGLVISGMFLTGIAANMP 398

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQ 309
            F ++G        I ++  +D +    C   F S    G+  L+ +I+S  L  
Sbjct: 399 LFYYLGTAACSSHLIWQLKTVDFNNPSSCLEKFISNKNFGLYFLLIIIVSKLLQD 453


>gi|332023983|gb|EGI64201.1| Para-hydroxybenzoate--polyprenyltransferase, mitochondrial
           [Acromyrmex echinatior]
          Length = 368

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 159/296 (53%), Gaps = 14/296 (4%)

Query: 18  AIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVT 77
            + PY+ L R    TG  L   PC WS  LAA     A  L      + L ++ +GA V 
Sbjct: 55  KVQPYMKLMRIDKPTGSWLLFWPCGWSIALAA----PASTL---PDLYMLTLFGMGAFVM 107

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           RGA C  ND+ D DID  V+RT+ RPL +GQ T  Q+L+F V Q  +  ++LLQ N + I
Sbjct: 108 RGAGCIINDMWDQDIDKMVVRTKDRPLVTGQITLKQSLIFLVGQLSLGLLILLQLNWYSI 167

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP-AFFLCIGTIF 196
            +G + L + ++YP  KR    PQ++LG+ F  G  +GW A+H S +W     L +  I 
Sbjct: 168 FLGASSLGLVIIYPLMKRVTYWPQLILGMTFNWGALLGWSAIHGSCNWSICLPLYVAGIC 227

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN-- 254
           W + +DT+YAHQD+ DD  IG+ STA  F   TK +L   +GI ++  ++   +LT    
Sbjct: 228 WTILYDTIYAHQDRLDDIRIGIKSTAIKFGEDTKFYLS-GFGIVMIASLITSGILTTQTW 286

Query: 255 -FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQ 309
            ++  IGL+ A      +I  L+I+    C   F S   +G+++ I +++   + +
Sbjct: 287 PYYTTIGLIAAHINN--QIYTLNINNPTDCFKKFMSNQNLGMILFIGIVLGNLMKK 340


>gi|12249121|dbj|BAB20425.1| p-hydroxybenzoate polyprenyl diphosphate [Schizosaccharomyces
           pombe]
 gi|94984078|gb|ABF50674.1| p-hydroxybenzoate polyprenyl diphosphate transferase
           [Schizosaccharomyces pombe]
          Length = 358

 Score =  152 bits (383), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 101/302 (33%), Positives = 147/302 (48%), Gaps = 26/302 (8%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  ++R  S TG +L   PC WS ++AAY    + V     +   L ++ VG+ + R A 
Sbjct: 66  YAEISRAGSPTGTYLLYSPCTWSILMAAYAYDSSLV----NVTKMLALFGVGSFLMRSAG 121

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  NDL D ++D++V R++SRPL SG+ +  QA+    +Q   S  +LLQ NP+ I +G 
Sbjct: 122 CVINDLWDRELDAKVERSKSRPLASGKLSVRQAISLLSVQLTASLGILLQLNPYTIKLGV 181

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL--HASFSWPAFF-LCIGTIFWV 198
           A L    +YP  KR    PQVVLG+ F  G  +GW AL   A  +W     L + TI W+
Sbjct: 182 ASLVPVCIYPAMKRITYYPQVVLGLTFGYGAVMGWPALAGEACMNWSVVAPLYLSTISWI 241

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTV----- 253
           V +DT+YAHQDK+DD    + STA  F   TK          VLC + A  + T+     
Sbjct: 242 VLYDTIYAHQDKRDDVKANIYSTALRFGDNTKP---------VLCGLAALQIATLATAGI 292

Query: 254 -----NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLD 308
                  F  +G+  A +     I  +D+   K C  +F      G L+   + +     
Sbjct: 293 MNGQGPVFYTLGVAGAAYRLSSMIYKVDLDDPKDCFRWFKRNSNTGYLVAAAIALDWLAK 352

Query: 309 QF 310
            F
Sbjct: 353 SF 354


>gi|295442948|ref|NP_593219.2| para-hydroxybenzoate--polyprenyltransferase Coq2
           [Schizosaccharomyces pombe 972h-]
 gi|259016199|sp|Q10252|COQ2_SCHPO RecName: Full=4-hydroxybenzoate polyprenyltransferase,
           mitochondrial; AltName: Full=P-hydroxybenzoate
           polyprenyl diphosphate transferase; AltName:
           Full=Para-hydroxybenzoate--polyprenyltransferase;
           Short=PHB:polyprenyltransferase; Flags: Precursor
 gi|254745506|emb|CAA93575.2| para-hydroxybenzoate--polyprenyltransferase Coq2
           [Schizosaccharomyces pombe]
          Length = 360

 Score =  152 bits (383), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 101/302 (33%), Positives = 147/302 (48%), Gaps = 26/302 (8%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  ++R  S TG +L   PC WS ++AAY    + V     +   L ++ VG+ + R A 
Sbjct: 68  YAEISRAGSPTGTYLLYSPCTWSILMAAYAYDSSLV----NVTKMLALFGVGSFLMRSAG 123

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  NDL D ++D++V R++SRPL SG+ +  QA+    +Q   S  +LLQ NP+ I +G 
Sbjct: 124 CVINDLWDRELDAKVERSKSRPLASGKLSVRQAISLLSVQLTASLGILLQLNPYTIKLGV 183

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL--HASFSWPAFF-LCIGTIFWV 198
           A L    +YP  KR    PQVVLG+ F  G  +GW AL   A  +W     L + TI W+
Sbjct: 184 ASLVPVCIYPAMKRITYYPQVVLGLTFGYGAVMGWPALAGEACMNWSVVAPLYLSTISWI 243

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTV----- 253
           V +DT+YAHQDK+DD    + STA  F   TK          VLC + A  + T+     
Sbjct: 244 VLYDTIYAHQDKRDDVKANIYSTALRFGDNTKP---------VLCGLAALQIATLATAGI 294

Query: 254 -----NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLD 308
                  F  +G+  A +     I  +D+   K C  +F      G L+   + +     
Sbjct: 295 MNGQGPVFYTLGVAGAAYRLSSMIYKVDLDDPKDCFRWFKRNSNTGYLVAAAIALDWLAK 354

Query: 309 QF 310
            F
Sbjct: 355 SF 356


>gi|332187381|ref|ZP_08389119.1| 4-hydroxybenzoate polyprenyl transferase [Sphingomonas sp. S17]
 gi|332012542|gb|EGI54609.1| 4-hydroxybenzoate polyprenyl transferase [Sphingomonas sp. S17]
          Length = 302

 Score =  152 bits (383), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 98/282 (34%), Positives = 143/282 (50%), Gaps = 12/282 (4%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           LAR+    GW L   P  W+  LA     R     W  + W+L    VGAI  RGA C +
Sbjct: 28  LARFDRPIGWWLLFWPGAWAIALAGGLPER-----WPMLLWFL----VGAIAMRGAGCVF 78

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND+VD D+D++V RTR+RP+PSG  +   A ++ V+  LI  V+L+Q  P    V    L
Sbjct: 79  NDIVDRDLDAKVARTRARPIPSGLVSVKLAAIWLVVLCLIGLVVLVQLRPLAAIVALVSL 138

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
                YPF KR    PQ  LG+ F+    VGW  +  + + P + L  G+I WV+ +DT+
Sbjct: 139 APVAAYPFMKRITWWPQAWLGMVFSWAALVGWAEIAGALTTPLWLLYAGSIAWVIGYDTI 198

Query: 205 YAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIA 264
           YA QD++DD LIGV S+A       K  +   Y I +LC+  A  L+  +  A +  LI 
Sbjct: 199 YALQDREDDALIGVRSSALRMGAHVKPGVGAFYLIAILCWAAAIWLVRPDVLA-VAALIP 257

Query: 265 LFLTIK-RIIALDISCSKQCCSFFHSAGVVGILI-LICLIIS 304
           + L +  +++ L           F S    G+L+ L C ++ 
Sbjct: 258 VALHLGWQVVTLKPDDGAGALYRFRSNRFAGLLMALACAVVG 299


>gi|47221448|emb|CAG08110.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 310

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 117/217 (53%), Gaps = 14/217 (6%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L R     G  L  LPC WS  LA+ P       G       L ++  GA++ RGA
Sbjct: 20  PYLRLMRLDKPIGTWLLYLPCTWSIALASDP-------GCLPHLGMLSLFGTGAVLMRGA 72

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL D D D +V RT +RPL SG+ +  QALVF   Q  ++  +LL  N + I +G
Sbjct: 73  GCTINDLWDQDFDKKVARTATRPLASGELSGMQALVFLGGQLSLALGVLLCLNYYSIALG 132

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW----PAFFLCIGTIF 196
            A L +   YP  KR    PQ+VLG+ F  G  +GW A+  S  W    P +F     + 
Sbjct: 133 AASLCLVFTYPLMKRITYWPQLVLGLTFNWGALLGWSAIKGSCDWSVCLPLYF---SGVM 189

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
           W + +DT+YAHQDK+DD  +GV STA  F  QTK WL
Sbjct: 190 WTLIYDTIYAHQDKEDDIKVGVKSTALRFQGQTKAWL 226


>gi|301120003|ref|XP_002907729.1| para-hydroxybenzoate-polyprenyltransferase, putative [Phytophthora
           infestans T30-4]
 gi|262106241|gb|EEY64293.1| para-hydroxybenzoate-polyprenyltransferase, putative [Phytophthora
           infestans T30-4]
          Length = 479

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 93/242 (38%), Positives = 127/242 (52%), Gaps = 8/242 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ +AR +      + + PC WS  +AA     AG L        L ++  G+ + RGA
Sbjct: 110 PYIQIARINRPGPTFMLLWPCFWSIAMAAP----AGQL---PDLKLLALFGTGSFIMRGA 162

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT ND+ D D D QV RT  RPL +G+ T  QA  F   Q      +LLQ N + I +G
Sbjct: 163 GCTINDMWDKDFDKQVERTNKRPLAAGKLTYPQAWGFLAGQLSAGLAVLLQLNWYSIAMG 222

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTIFWVV 199
            + L +   YP  KRF   PQ VLG+ F  G  +GW A+H S  WP    L  G + W +
Sbjct: 223 ASSLALVATYPTMKRFTYWPQAVLGLTFNYGALLGWAAVHGSCEWPVVLPLYAGGVAWTL 282

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
            +DT+YAHQDKKDD  IGV STA LF  +TK  L +     +  F  A  +  +++  ++
Sbjct: 283 VYDTLYAHQDKKDDIKIGVRSTALLFGDKTKPVLNLFSAATIAGFGTAGYMAGLDWPFFL 342

Query: 260 GL 261
           GL
Sbjct: 343 GL 344


>gi|194209011|ref|XP_001493283.2| PREDICTED: similar to Coenzyme Q2 homolog, prenyltransferase
           (yeast) [Equus caballus]
          Length = 296

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 95/275 (34%), Positives = 143/275 (52%), Gaps = 14/275 (5%)

Query: 39  LPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLR 98
           LPC WS  LAA P       G    ++ L ++  GA++ RGA CT ND+ D D D +V R
Sbjct: 16  LPCTWSIGLAAEP-------GCFPDWYMLSLFGTGAVLMRGAGCTINDMWDRDYDKKVTR 68

Query: 99  TRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFIL 158
           T +RP+ +G  + F++ VF   Q  ++  +LL  N + + +G A L + + YP  KR   
Sbjct: 69  TANRPIAAGDISTFRSFVFLGGQLTLALGVLLCLNYYSVALGAASLLLVITYPLMKRVTY 128

Query: 159 CPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIFWVVYFDTVYAHQDKKDDELI 216
            PQ+ LG+ F  G  +GW A+  S   P+  L +    I W + +DT+YAHQDKKDD LI
Sbjct: 129 WPQLALGLAFNWGALLGWSAVKGSCD-PSVCLPLYFSGIMWTLIYDTIYAHQDKKDDALI 187

Query: 217 GVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIA 274
           G+ STA  F   TK WL  F +  +  L  +      T  ++A +  + A     ++I  
Sbjct: 188 GLKSTALWFREDTKQWLSGFSVAMVGALSLVGVSSEQTAPYYAALAAVGAHL--ARQIYT 245

Query: 275 LDISCSKQCCSFFHSAGVVGILILICLIISLFLDQ 309
           LDI   + C   F S   VG++I + +++     Q
Sbjct: 246 LDIHRPEDCWDKFTSNRTVGLIIFLGIVLGNLWKQ 280


>gi|321253223|ref|XP_003192671.1| prenyltransferase [Cryptococcus gattii WM276]
 gi|317459140|gb|ADV20884.1| prenyltransferase, putative [Cryptococcus gattii WM276]
          Length = 370

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 86/222 (38%), Positives = 122/222 (54%), Gaps = 5/222 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+YL R     G  L   PC WS  +A+        L  +T  +Y+ ++ VGA++ RGA
Sbjct: 78  PYLYLTRLDKPIGSLLLYWPCAWSITMAS----TVHHLPPATPLFYMSLFAVGAVIMRGA 133

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT ND+ D  +D++V RT++RPL +G  T+F AL F   Q      +L Q N + I +G
Sbjct: 134 GCTINDMWDRKMDAKVERTKTRPLAAGDVTQFGALTFLGAQLTAGLAVLTQLNWYSIALG 193

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP-AFFLCIGTIFWVV 199
            + L + ++YPF KR    PQVVLG  F  GV +GW A+  +  W  A  + +G   W V
Sbjct: 194 TSSLGLVVIYPFMKRITYFPQVVLGFAFNWGVLLGWSAVAGAVDWTIATPMYLGGAAWCV 253

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFV 241
            +D +YAHQDKKDD + GV S A  F   ++  +  L   FV
Sbjct: 254 AYDIIYAHQDKKDDVIAGVKSMALRFPDTSRQVISTLSASFV 295


>gi|126330904|ref|XP_001376897.1| PREDICTED: similar to Coenzyme Q2 homolog, prenyltransferase
           (yeast) [Monodelphis domestica]
          Length = 299

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 94/269 (34%), Positives = 142/269 (52%), Gaps = 12/269 (4%)

Query: 39  LPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLR 98
           LPC WS  LAA P       G    ++ L ++  GA++ RGA CT ND+ D + D +V R
Sbjct: 22  LPCTWSIGLAAEP-------GCFPDWYMLSLFGTGAVLMRGAGCTINDMWDQEYDKKVTR 74

Query: 99  TRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFIL 158
           T +RP+ +G  + FQ+L+F   Q  ++  +LL  N + I +G A L + ++YP  KR   
Sbjct: 75  TANRPIAAGDISTFQSLIFLGGQLSLALCVLLCLNYYSIALGAASLSLVVIYPLMKRITY 134

Query: 159 CPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTIFWVVYFDTVYAHQDKKDDELIG 217
            PQ+ LG+ F  G  +GW A+  S        L +  + W + +DT+YAHQDK+DD LIG
Sbjct: 135 WPQLALGLTFNWGALLGWSAIKGSCDVSVCLPLYLSGVMWTLIYDTIYAHQDKRDDALIG 194

Query: 218 VNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIAL 275
           + STA  F   TK WL  F +  +  L      C  T+ ++A +  + A      +I  L
Sbjct: 195 LKSTALRFKEDTKQWLSGFSIVMLSGLTLAGLNCDQTIPYYAAVATIGAHL--AHQIYTL 252

Query: 276 DISCSKQCCSFFHSAGVVGILILICLIIS 304
           DI   + C + F S   VG ++ I +I+ 
Sbjct: 253 DIHKPEDCWAKFTSNRTVGFVLFIGIILG 281


>gi|298713626|emb|CBJ33678.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 287

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 121/218 (55%), Gaps = 8/218 (3%)

Query: 14  IMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVG 73
           ++G   +PY  LAR     G  L + PC WS  LAA P+   G L  + +   + ++  G
Sbjct: 1   MLGPRWSPYGRLARIDKPAGTLLLLFPCWWSIALAA-PM---GTLPDAKL---MALFATG 53

Query: 74  AIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFN 133
           +++ R A CT NDL D D D +V RT+ RPL SG+    QA+ F   Q  +   +LL  N
Sbjct: 54  SVLMRSAGCTINDLWDKDFDRKVTRTKQRPLASGELGNTQAIAFLGAQLTLGLGVLLSLN 113

Query: 134 PFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIG 193
              I +GFA++ + + YP  KR+   PQ VLG+ F  G  +GW A+H S SW       G
Sbjct: 114 IECIKLGFAVMPLVVAYPLMKRYTDWPQAVLGLTFNWGAIMGWAAVHGSASWEHVLPLYG 173

Query: 194 TIF-WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
             F W + +DT+Y HQDK DD+ +G+ STA LF  +TK
Sbjct: 174 AGFCWTLVYDTLYGHQDKADDKRLGIRSTALLFGDRTK 211


>gi|12843667|dbj|BAB26064.1| unnamed protein product [Mus musculus]
          Length = 302

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 88/217 (40%), Positives = 120/217 (55%), Gaps = 10/217 (4%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GAI+ R
Sbjct: 71  LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAADP-------GCFPDWYMLSLFGTGAILMR 123

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT +RP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 124 GAGCTINDMWDRDFDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIA 183

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G A L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   PA  L +    + 
Sbjct: 184 MGAASLLLVVTYPLVKRITFWPQLALGLTFNWGALLGWSAVKGSCD-PAVCLPLYFSGVM 242

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
           W + +DT+YAHQDKKDD LIG+ STA LF   T+ WL
Sbjct: 243 WTLIYDTIYAHQDKKDDALIGLKSTALLFQENTRQWL 279


>gi|224081373|ref|XP_002306387.1| predicted protein [Populus trichocarpa]
 gi|222855836|gb|EEE93383.1| predicted protein [Populus trichocarpa]
          Length = 299

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 122/228 (53%), Gaps = 11/228 (4%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
            WV D  +   + PY +LAR     G  L   P +WS  LAA P       G    +  +
Sbjct: 6   SWV-DVYLPRQVRPYAHLARIDKQIGTWLLAWPTMWSITLAAAP-------GNLPDYKMI 57

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
            ++ +G+++ R  ACT ND++D DID++V RT+ RPL SG     Q ++F   Q  +   
Sbjct: 58  GLFALGSLLVRSIACTINDILDRDIDAKVDRTKRRPLASGVLKPSQGVLFLGFQLFLGLG 117

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           +LLQ N +   +G   +F+   YP  KRF   PQ  LG  F+ G  +GW A+  S   PA
Sbjct: 118 ILLQLNNYSRVLGVLSMFLVFTYPLMKRFTYWPQAYLGFTFSWGALLGWSAVKGSLD-PA 176

Query: 188 FFLCI--GTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
             L +    IFW + +DT+YAHQDK+DD  +GV STA LF   TK W+
Sbjct: 177 IVLPLYASGIFWTLVYDTIYAHQDKEDDLKVGVKSTALLFGDSTKEWI 224


>gi|170043503|ref|XP_001849425.1| para-hydroxybenzoate-polyprenyltransferase, mitochondrial [Culex
           quinquefasciatus]
 gi|167866821|gb|EDS30204.1| para-hydroxybenzoate-polyprenyltransferase, mitochondrial [Culex
           quinquefasciatus]
          Length = 315

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 148/276 (53%), Gaps = 16/276 (5%)

Query: 40  PCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRT 99
           PC WS  L+A     AG   W      L ++  G+ + RGA CT ND+ D DID++V RT
Sbjct: 15  PCGWSIALSA----PAGC--WPDPV-MLALFGTGSFIMRGAGCTINDMWDRDIDAKVART 67

Query: 100 RSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILC 159
           +SRPL +G+ T+  A +F   Q  +  ++LL+ N + I +G + L + ++YP  KR    
Sbjct: 68  KSRPLVAGELTQLDAWMFLGGQLAVGLLVLLELNWYSIVLGASSLGLVIVYPLMKRITHW 127

Query: 160 PQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTIFWVVYFDTVYAHQDKKDDELIGV 218
           PQ+VLG+ F  G  +GW A   S  W A   L +  + W + +DT+YAHQDK DD L+G+
Sbjct: 128 PQLVLGMTFNWGALLGWSATTGSVEWSACLPLYLAGVCWTIVYDTIYAHQDKVDDVLLGI 187

Query: 219 NSTARLFSYQTKLWL----FILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIA 274
            STA  F   TKLWL      + G  V   +V  C  T  +++ +G++ A      +I +
Sbjct: 188 KSTAIRFGDNTKLWLTGFSTAMLGGLVSSGIV--CDQTWPYYSALGIISAHL--AHQIYS 243

Query: 275 LDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
           L+I     C + F S   VG+++ + +++      +
Sbjct: 244 LNIHNPTDCANKFISNHQVGLILFLGIVLGTLYKGY 279


>gi|315498600|ref|YP_004087404.1| 4-hydroxybenzoate polyprenyl transferase [Asticcacaulis excentricus
           CB 48]
 gi|315416612|gb|ADU13253.1| 4-hydroxybenzoate polyprenyl transferase [Asticcacaulis excentricus
           CB 48]
          Length = 308

 Score =  149 bits (375), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 98/298 (32%), Positives = 147/298 (49%), Gaps = 9/298 (3%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVL-AAYPLRRAGVLGWSTIFWY 66
            WV D    + + P++ L R+    G  L  LP     V  AA PL          + + 
Sbjct: 15  NWV-DLYAPAPLRPWLRLGRFDRPIGIWLLFLPGAMGLVFGAADPLS-------PEVAYK 66

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L ++ +G+ + RGA C +ND VD D D+QV RTR RP+PSGQ +  QAL+F  L  LIS 
Sbjct: 67  LVLFALGSALMRGAGCAYNDFVDRDFDAQVERTRLRPIPSGQISPKQALLFVALSALISL 126

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           V+LLQ  P  I +G A L +   YPF KR    PQ  LG+ F  G  +G   +  + S  
Sbjct: 127 VILLQLGPTAIWLGVASLGLVAAYPFMKRITWWPQAWLGLTFNWGFLMGVATMKGTLSLA 186

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV 246
           A     G IFW + +DT+YA+QD +DD +IGV S+AR    + K  + + Y   V    +
Sbjct: 187 AVLFYAGLIFWTLGYDTIYAYQDIEDDAMIGVKSSARALGAKGKSGVSLFYAAAVALTGI 246

Query: 247 AFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
              +  +++  + GL         ++  L I  + +    F +    G+L +  ++I 
Sbjct: 247 GAIVGGLSWPLYAGLAAVCLHLFWQVNTLRIDDNARLLKLFKANRDTGLLWVTAILIG 304


>gi|307106917|gb|EFN55161.1| hypothetical protein CHLNCDRAFT_9858 [Chlorella variabilis]
          Length = 285

 Score =  148 bits (374), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 96/280 (34%), Positives = 132/280 (47%), Gaps = 12/280 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L   PCLWS  LAA P       G S     + ++ +GA++ RGA
Sbjct: 6   PYAQLMRLEKPIGTWLLAWPCLWSICLAAPP-------GTSPDLRLMALFGLGAVLLRGA 58

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL D ++D +V RTR RPL +G  T  QA+ F   Q      +L+Q NP+   +G
Sbjct: 59  GCTINDLWDRELDRRVERTRGRPLAAGAVTPAQAVAFLAAQLSAGLAILVQLNPYSQLLG 118

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTIFWVV 199
            + L +   YP  KR    PQ  LG+ F  G  +GW A+H S  W     L    + W +
Sbjct: 119 ASSLALVAAYPLMKRVTGWPQAFLGLTFNWGALLGWAAVHGSCQWGVVLPLYASGVCWTL 178

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLW--LFILYGIFVLCFMVAFCLLTVNFFA 257
            +DT+YAHQDK DD   G+ STA  F  +TK +   F    I +L            F+A
Sbjct: 179 VYDTIYAHQDKSDDVKAGIRSTALTFGPRTKHYCAAFGAGAIALLALTGQAAGCGPAFYA 238

Query: 258 WIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
             G+  A      ++  +D+     C + F S    G L+
Sbjct: 239 --GVTAAAGHLAWQVTTVDLDSGPDCQAKFVSNAGYGALV 276


>gi|156545796|ref|XP_001605798.1| PREDICTED: similar to ENSANGP00000012220 [Nasonia vitripennis]
          Length = 414

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 148/288 (51%), Gaps = 8/288 (2%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S I PY+ L R     G  L   PC WS  +AA     AG      +   L ++ +GA +
Sbjct: 100 SKIQPYMKLMRIDKPIGSWLLFWPCGWSIAMAA----PAGAFPDPGM---LALFGIGAFI 152

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT ND+ D DID +V RT+ RPL +G+ ++ QAL F   Q  +  ++LLQ N + 
Sbjct: 153 MRGAGCTINDMWDKDIDKKVARTKDRPLVTGEVSQMQALTFLGGQLSLGLLVLLQLNWYS 212

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTI 195
           I +G + L + ++YP  KR    PQ++LG+ F  G  +GW A+  S  W     L    I
Sbjct: 213 IILGASSLGLVIIYPLMKRITYWPQLILGMTFNWGALLGWSAIQGSCDWSVCLPLYTAGI 272

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT+YAHQDK DD L+G+ STA  F  +TKL+L       +   +V+       F
Sbjct: 273 CWTILYDTIYAHQDKIDDVLLGIKSTALKFGDKTKLYLASFGTTMISSLVVSGICADQTF 332

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLII 303
             +I + +       ++  LDI+    C   F S   VG+++   +++
Sbjct: 333 PYYIAVGLVGSHLFHQLYTLDINDPSNCAKKFISNHKVGMILFAGIVL 380


>gi|58264750|ref|XP_569531.1| prenyltransferase [Cryptococcus neoformans var. neoformans JEC21]
 gi|134109887|ref|XP_776493.1| hypothetical protein CNBC5470 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50259169|gb|EAL21846.1| hypothetical protein CNBC5470 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57225763|gb|AAW42224.1| prenyltransferase, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 373

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 121/222 (54%), Gaps = 5/222 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+YL R     G  L   PC WS  +A+        L  +T  +Y+ ++ VGA++ RGA
Sbjct: 81  PYLYLTRLDKPIGSVLLYWPCAWSITMAS----TVNHLPPTTPLFYMSLFAVGALIMRGA 136

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT ND+ D  +D++V RT++RPL +G  T+F AL F   Q      +L Q N + I +G
Sbjct: 137 GCTINDMWDWKMDAKVERTKTRPLAAGDVTQFGALTFLGAQLTAGLAVLTQLNWYSIVLG 196

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP-AFFLCIGTIFWVV 199
            + L + ++YPF KR    PQVVLG  F  G  +GW A+  +  W  A  + +G   W V
Sbjct: 197 ASSLGLVVIYPFMKRITYFPQVVLGFAFNWGALLGWSAVAGAVDWTIATPMYLGGAAWCV 256

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFV 241
            +D +YAHQDKKDD + GV S A  F   ++  +  L   FV
Sbjct: 257 AYDIIYAHQDKKDDVIAGVKSMALRFPDTSRQVISTLSASFV 298


>gi|219119095|ref|XP_002180314.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217408571|gb|EEC48505.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 300

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 103/305 (33%), Positives = 147/305 (48%), Gaps = 20/305 (6%)

Query: 12  DCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYI 71
           D  + S   PY  LAR     G  L + PC WST LA  P    G L   ++   L ++ 
Sbjct: 4   DTYLPSTWKPYARLARMDKPIGTWLLLWPCYWSTALATSP--GVGSLPDPSL---LALFG 58

Query: 72  VGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQ 131
           VGA+V RGA CT ND+ D D+D QV RT SRPL SG  T+ QA  F   Q      +LL 
Sbjct: 59  VGAVVMRGAGCTINDIWDADVDRQVSRTSSRPLASGAVTQSQAWAFLAAQLTTGLAVLLS 118

Query: 132 FNPFVICV--GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF 189
               + C   G A L + + YP  KRF   PQ+VLG+ F  G ++GW A H S      F
Sbjct: 119 LPHTMYCFYWGAASLPLVVAYPAMKRFFPYPQLVLGLTFNWGAWMGWAATHGSMD----F 174

Query: 190 LCIGTIF-----WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFV--- 241
             +G ++     W + +DT+YAHQDK +D  +G+ STA  F    +    IL+G+ +   
Sbjct: 175 AVVGPLYMSGITWTLVYDTIYAHQDKVEDRQLGLQSTALTFGEDNQQ-RRILHGLAMATY 233

Query: 242 LCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICL 301
           L +M+      +    + G+  A      ++ + D +      + F S   VG L+   L
Sbjct: 234 LQWMLVGHQAELAAVYYAGITAAYGHLAWQVQSADFNEPHNVMTRFRSNSAVGALVFGSL 293

Query: 302 IISLF 306
           +   +
Sbjct: 294 VAGTY 298


>gi|307179433|gb|EFN67757.1| Para-hydroxybenzoate--polyprenyltransferase, mitochondrial
           [Camponotus floridanus]
          Length = 339

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 100/297 (33%), Positives = 155/297 (52%), Gaps = 14/297 (4%)

Query: 18  AIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVT 77
            + PY+ L R     G  L   PC WS  +AA        +G       L ++  GA + 
Sbjct: 24  KVQPYMKLMRIDKPIGSWLLFWPCSWSIAMAA-------PIGALPDLQMLALFGTGAFIM 76

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           RGA CT ND+ D DID  V RT+ RPL SGQ T  Q+L+F   Q  +  ++LLQ N + I
Sbjct: 77  RGAGCTINDMWDQDIDKMVDRTKDRPLVSGQITPRQSLMFLAGQLSLGLLVLLQLNWYSI 136

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP-AFFLCIGTIF 196
            +G + L + + YP  KR    PQ++LG+ F  G  +GW A+  S  W     L I  I 
Sbjct: 137 FLGASSLGLVITYPLMKRITYWPQLILGMTFNWGALLGWSAIRGSCDWSICLPLYIAGIC 196

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN-- 254
           W + +DT+YAHQD+ DD L+G  STA  F   TK +L   +G+ ++  ++   +LT    
Sbjct: 197 WTILYDTIYAHQDRVDDILLGTKSTAIKFGDDTKFYLS-GFGMVMIASLITSGILTTQTW 255

Query: 255 -FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
            ++  +G LIA+ ++  +I  L+I+    C   F S   VG+++ + +++   + + 
Sbjct: 256 PYYTAVG-LIAIHIS-NQIYTLNINNPTDCAKKFISNHRVGMILFVGIVLGNLMKRL 310


>gi|83859510|ref|ZP_00953031.1| 4-hydroxybenzoate octaprenyltransferase [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852957|gb|EAP90810.1| 4-hydroxybenzoate octaprenyltransferase [Oceanicaulis alexandrii
           HTCC2633]
          Length = 308

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 145/291 (49%), Gaps = 24/291 (8%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           +AI PY+ LAR+    G+ L  +PC     LA+     +  L W  ++W + ++ +GAI 
Sbjct: 23  TAIRPYLRLARYDRPVGFWLLAIPCWQGLALASV----STGLDWMDLYWAI-LFGIGAIA 77

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT+ND+VD DID+QV RT  RPL +G  +  QA  F V Q L+  ++L+Q     
Sbjct: 78  MRGAGCTYNDIVDRDIDAQVARTADRPLAAGTVSLKQAWAFLVAQCLVGLLVLIQLPWPA 137

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFV-GWGALHASFSWPAFFLCIGTI 195
           I  G   L +   YPF KR    PQ  LG+ F  GV V G  AL   F+     L +  +
Sbjct: 138 ILTGLGALALVAGYPFMKRITWWPQAWLGLTFNWGVPVAGAAALGTPFAPEIMLLYVANL 197

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
           FW + +DT+YA QD +DD ++GV S+AR           I +G+ V     A        
Sbjct: 198 FWTLGYDTIYACQDMEDDAMVGVKSSARALGGN------IPFGVLVFYLACAALAALAGV 251

Query: 256 FAWIGLLIA---------LFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
           FA  GL+ A         L L  ++   LD S   +C   F +  + G+L+
Sbjct: 252 FAGAGLMFAPAFAIFAAHLLLQARK---LDPSDGAECLRRFKANQITGLLL 299


>gi|299747876|ref|XP_002911228.1| para-hydroxybenzoate-polyprenyltransferase [Coprinopsis cinerea
           okayama7#130]
 gi|298407719|gb|EFI27734.1| para-hydroxybenzoate-polyprenyltransferase [Coprinopsis cinerea
           okayama7#130]
          Length = 364

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 103/282 (36%), Positives = 142/282 (50%), Gaps = 9/282 (3%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+YL R     G  L   PC WS  +A+Y L     L  S    Y+ +  +GA+V R
Sbjct: 73  VRPYLYLTRIDKPIGTLLLFWPCTWSIAMASYALH----LPPSVPLTYISLCGIGALVMR 128

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D ++D  V RT+ RPL  G  TR  A +F   Q  +   +LLQFN + I 
Sbjct: 129 GAGCTINDMWDKNLDKSVARTKERPLARGDLTRKDAFIFLGGQLGLGLAVLLQFNWYSIL 188

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTIFW 197
           +G + L +  +YPF KR    PQ VLG+ F  G  +GW A+  +  W     L  G + W
Sbjct: 189 LGASSLSLVTIYPFMKRVTHWPQAVLGLAFNWGALLGWSAVAGTVDWAVCLPLYAGGVCW 248

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCL--LTVNF 255
            + +D++YAHQDK DD   G+ STA LF+ +T+  L  L    +     A  L   T  F
Sbjct: 249 TLVYDSIYAHQDKLDDVHAGIKSTALLFADKTRSILTGLSLSSMSLVSYAGYLNHQTEPF 308

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
           +A + L +A    I  +   D    K C   F S+G VG  I
Sbjct: 309 YAGVALGLAQLGRI--LYRTDFEDRKSCWEGFASSGWVGFWI 348


>gi|119626335|gb|EAX05930.1| coenzyme Q2 homolog, prenyltransferase (yeast), isoform CRA_d [Homo
           sapiens]
          Length = 331

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 126/238 (52%), Gaps = 14/238 (5%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GAI+ R
Sbjct: 84  LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEP-------GCFPDWYMLSLFGTGAILMR 136

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT +RP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 137 GAGCTINDMWDQDYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIA 196

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G   L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   P+  L +    + 
Sbjct: 197 LGAGSLLLVITYPLMKRISYWPQLALGLTFNWGALLGWSAIKGSCD-PSVCLPLYFSGVM 255

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
           W + +DT+YAHQDK+DD LIG+ STA  F   TK WL      F +  + A  L+ VN
Sbjct: 256 WTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWL----SGFSVAMLGALSLVGVN 309


>gi|119626332|gb|EAX05927.1| coenzyme Q2 homolog, prenyltransferase (yeast), isoform CRA_a [Homo
           sapiens]
          Length = 341

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 126/238 (52%), Gaps = 14/238 (5%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GAI+ R
Sbjct: 84  LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEP-------GCFPDWYMLSLFGTGAILMR 136

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT +RP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 137 GAGCTINDMWDQDYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIA 196

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G   L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   P+  L +    + 
Sbjct: 197 LGAGSLLLVITYPLMKRISYWPQLALGLTFNWGALLGWSAIKGSCD-PSVCLPLYFSGVM 255

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
           W + +DT+YAHQDK+DD LIG+ STA  F   TK WL      F +  + A  L+ VN
Sbjct: 256 WTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWL----SGFSVAMLGALSLVGVN 309


>gi|255561866|ref|XP_002521942.1| 4-hydroxybenzoate octaprenyltransferase, putative [Ricinus
           communis]
 gi|223538867|gb|EEF40466.1| 4-hydroxybenzoate octaprenyltransferase, putative [Ricinus
           communis]
          Length = 387

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 105/275 (38%), Positives = 141/275 (51%), Gaps = 22/275 (8%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LAR     G  L   PC+WS  LAA P       G    F  + ++  GA++ RGA
Sbjct: 125 PYARLARLDKPIGTWLLAWPCMWSISLAASP-------GHLPDFKMMVLFGCGALLLRGA 177

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL+D DID++V RT+ RP+ SG  + FQ L F   Q L+   +LLQ N +   +G
Sbjct: 178 GCTVNDLLDRDIDTKVERTKLRPVASGLLSPFQGLSFLGFQLLLGLGILLQLNNYSRILG 237

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLC--IGTIFWV 198
            + LF+   YP  KR    PQ  LG+ F  G  +GW A+  S   PA  L   +  +FW 
Sbjct: 238 ASSLFLVFSYPLMKRLTFWPQAYLGLTFNWGALLGWSAIKGSLD-PAVVLPLYMSGVFWT 296

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+YAHQDK+DD  +GV STA  F   TK W   + G  + C + +  L  VN  A 
Sbjct: 297 LVYDTIYAHQDKEDDLKVGVKSTALRFGDSTKEW---ITGFGIAC-IGSLALSGVN--AN 350

Query: 259 IGLLIALFLTIK------RIIALDISCSKQCCSFF 287
           IG     FLT        +I  +D+SC   C   +
Sbjct: 351 IGWPFYAFLTAGSGHLAWQIWTVDLSCRSDCNKKY 385


>gi|114593903|ref|XP_001136138.1| PREDICTED: para-hydroxybenzoate-polyprenyltransferase,
           mitochondrial isoform 1 [Pan troglodytes]
          Length = 341

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 126/238 (52%), Gaps = 14/238 (5%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L  LPC WS  LAA P       G    ++ L ++  GAI+ R
Sbjct: 84  LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEP-------GCFPDWYMLSLFGTGAILMR 136

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D D D +V RT +RP+ +G  + FQ+ VF   Q  ++  +LL  N + I 
Sbjct: 137 GAGCTINDMWDQDYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIA 196

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           +G   L + + YP  KR    PQ+ LG+ F  G  +GW A+  S   P+  L +    + 
Sbjct: 197 LGAGSLLLVITYPLMKRISYWPQLALGLTFNWGALLGWSAIKGSCD-PSVCLPLYFSGVM 255

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
           W + +DT+YAHQDK+DD LIG+ STA  F   TK WL      F +  + A  L+ VN
Sbjct: 256 WTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWL----SGFSVAMLGALSLVGVN 309


>gi|170091938|ref|XP_001877191.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164648684|gb|EDR12927.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 360

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 85/220 (38%), Positives = 118/220 (53%), Gaps = 12/220 (5%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PYV+L R     G  L   PC WS  +A+Y L+      ++    Y+ ++ +GA+V R
Sbjct: 64  VQPYVHLTRIDKPIGTLLLFYPCAWSITMASYALQTP----YTVPLTYMSLFGLGALVMR 119

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFN----P 134
           GA CT ND+ D ++D  V RTR RPL  G  T+ QALVF   Q      +L+Q N    P
Sbjct: 120 GAGCTINDMWDKNLDKAVDRTRDRPLARGDITQNQALVFLGGQLAAGLGVLMQINWYRQP 179

Query: 135 FV---ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFL 190
            +   I +G + L +  +YP  KR    PQ VLG+ F  G  +GW A+  S  W     L
Sbjct: 180 HIFYSIFLGASSLSLVTIYPLMKRITHWPQAVLGLAFNWGALLGWSAVAGSADWSVCLPL 239

Query: 191 CIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
             G + W + +D++YAHQDK DD   G+ STA LF  QT+
Sbjct: 240 YAGGVCWTLVYDSIYAHQDKNDDVHAGIRSTALLFGPQTR 279


>gi|260833270|ref|XP_002611580.1| hypothetical protein BRAFLDRAFT_63772 [Branchiostoma floridae]
 gi|229296951|gb|EEN67590.1| hypothetical protein BRAFLDRAFT_63772 [Branchiostoma floridae]
          Length = 270

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 82/237 (34%), Positives = 122/237 (51%), Gaps = 5/237 (2%)

Query: 74  AIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFN 133
           +++ RGA CT NDL D DID +V RT+SRPL SG+ ++  A++F   Q  ++  +LL  N
Sbjct: 21  SVIMRGAGCTINDLWDRDIDKKVARTQSRPLASGKISQRNAVLFLGAQLSVALCILLSLN 80

Query: 134 PFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCI 192
            + + +GF+ + +   YP  KR    PQVVLG+    G  +GW A+  S  W     L +
Sbjct: 81  SYSVLLGFSSMLLVSTYPLFKRVTYWPQVVLGLTINWGALLGWAAVKGSCDWSVVLPLYL 140

Query: 193 GTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA--FCL 250
           G   W + +DT+YAHQDK DD LIGV STA  F   T+ WL       V   +++   C 
Sbjct: 141 GAAAWTMVYDTIYAHQDKADDMLIGVKSTALRFGEDTRAWLSGFSAAMVSGLLLSGLMCE 200

Query: 251 LTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
            T  ++A +GL  A      ++        + C   F S   +G +I   ++    L
Sbjct: 201 QTWPYYAAVGLTGAHLYN--QVATAKFDKPEDCWKKFSSNKRLGAIIFAGIVAGTIL 255


>gi|254456555|ref|ZP_05069984.1| 4-hydroxybenzoate polyprenyl transferase [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207083557|gb|EDZ60983.1| 4-hydroxybenzoate polyprenyl transferase [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 276

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 88/276 (31%), Positives = 149/276 (53%), Gaps = 6/276 (2%)

Query: 33  GWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDI 92
           G+ L   PCLW   L  Y  + + +  +   F+Y  +++ G+I+ R A C  ND+ D + 
Sbjct: 6   GFMLLFWPCLWGLTLV-YNFQ-SNLFNY---FFYSILFLSGSILMRSAGCIVNDIADKNF 60

Query: 93  DSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPF 152
           D +V RT+ RP+ SG+ +   A ++A++   I+F++L+ FN   I +    + ++  YP 
Sbjct: 61  DKKVERTKKRPIASGKVSVKLASIYALILCGIAFLVLINFNKLTILMALISMPLAFTYPL 120

Query: 153 SKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKD 212
            KR    PQ+ LGI F  G+ + W ++    S       +G IFW + +DT+Y  QD KD
Sbjct: 121 MKRITYWPQLFLGITFNYGLVLAWISIANEISIIPIIFYLGAIFWTLGYDTIYGFQDIKD 180

Query: 213 DELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIA-LFLTIKR 271
           DE+IGV ST+  F    K +LFI Y IF++   +   L++  ++ +I ++   L L I +
Sbjct: 181 DEIIGVKSTSIKFKNDPKKFLFISYCIFIISLFLIGVLMSFKYYYFIFMIFPILHLLIFQ 240

Query: 272 IIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
           I  L+ +    C + F S   +G++I I ++I   L
Sbjct: 241 IKRLNTNSPSDCLNKFKSNNFLGMIIFINILIGKLL 276


>gi|326509033|dbj|BAJ86909.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 391

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 118/221 (53%), Gaps = 10/221 (4%)

Query: 15  MGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGA 74
           +  A  PY  LAR     G  L   PC+WS  +AA P       G       L ++  GA
Sbjct: 104 LPEAARPYAMLARLDKPIGTWLLAWPCMWSITIAAMP-------GELPDLKMLALFGCGA 156

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
           ++ RGA CT NDL+D DID++V RT+SRP  SG  T  Q + F   Q L+   +LLQ N 
Sbjct: 157 VLLRGAGCTVNDLLDRDIDNKVERTKSRPFASGALTPTQGVCFLGGQLLLGLGILLQLNN 216

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT 194
           F   +G + L +   YP  KRF   PQ  LG+ F  G  +GW A+  S   PA  L + T
Sbjct: 217 FSRVLGASSLLLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAIRGSLD-PAVILPLYT 275

Query: 195 --IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
             I W + +DT+YAHQDK+DD  +GV STA  F   TK W+
Sbjct: 276 AGICWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDSTKQWI 316


>gi|270011210|gb|EFA07658.1| hypothetical protein TcasGA2_TC030623 [Tribolium castaneum]
          Length = 294

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 93/269 (34%), Positives = 139/269 (51%), Gaps = 17/269 (6%)

Query: 40  PCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRT 99
           PC W    AA P       G     + L ++  GA++ RGA CT ND+ D DIDS+V RT
Sbjct: 15  PCGWGIASAAAP-------GCFPDPYMLALFGTGAVIMRGAGCTINDMWDRDIDSKVART 67

Query: 100 RSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILC 159
           + RPL +G  +   A VF   Q  +   +LLQ N + + +G + + + + YP  KRF   
Sbjct: 68  KDRPLVNGDVSMKAAWVFLAGQLSLGLAVLLQLNWYSVFLGASSMGLVISYPLMKRFTYW 127

Query: 160 PQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTIFWVVYFDTVYAHQDKKDDELIGV 218
           PQ+VLG+ F  GV +G+ A+      P    L + ++ W + +DT+YAHQD+ DD  +G+
Sbjct: 128 PQLVLGLTFNWGVLLGYSAIKGHVDLPVCLPLYLASVCWTIIYDTIYAHQDRADDYKLGI 187

Query: 219 NSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW----IGLLIALFLTIKRIIA 274
            STA  F   TKLWL     + +   +++  +   N  AW       L+A  L   ++  
Sbjct: 188 KSTALKFDRDTKLWLSGFSAVMMGGVVLSGIM---NEMAWPYYASTALVASHLA-SQLFT 243

Query: 275 LDISCSKQCCSFFHSAGVVGILILICLII 303
           L+I  +  C + F S   VG LIL C I+
Sbjct: 244 LNIDNASDCSNKFVSNAQVG-LILFCGIV 271


>gi|302694221|ref|XP_003036789.1| hypothetical protein SCHCODRAFT_46716 [Schizophyllum commune H4-8]
 gi|300110486|gb|EFJ01887.1| hypothetical protein SCHCODRAFT_46716 [Schizophyllum commune H4-8]
          Length = 369

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 132/279 (47%), Gaps = 5/279 (1%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           + + PY+YL R     G  L   PC WS  +A+Y    A  L       Y  ++ +GA+V
Sbjct: 66  AKLRPYLYLTRIDKPIGTLLLFYPCAWSITMASY----AHQLPLGVPVKYTLLFGLGALV 121

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT NDL D ++D  V RT++RP+ +G  T  QA+ F  LQ      +L Q N + 
Sbjct: 122 MRGAGCTINDLWDRNLDKAVARTKARPIAAGDITPPQAIAFLGLQLSAGLAVLTQLNWYS 181

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTI 195
           I +G + L +  +YP  KR    PQ VLG+ F  G  +GW A+     W     L  G +
Sbjct: 182 ILLGASSLSLVTIYPLMKRITHWPQAVLGLAFNWGALLGWSAVSGVTDWTVCLPLYAGGL 241

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DTVYAHQDK DD   G+ STA LF   ++  L  L    +     +  L     
Sbjct: 242 CWTLVYDTVYAHQDKNDDVHAGIRSTALLFGDHSRTVLSALSTASMSLVAYSGFLNAAGA 301

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVG 294
             ++G+ +      + +   D +  K C   F   G  G
Sbjct: 302 PFYLGVGVGAAQLARVLYRTDFNSRKSCWDGFVGCGWTG 340


>gi|114799354|ref|YP_760085.1| 4-hydroxybenzoate polyprenyl transferase [Hyphomonas neptunium ATCC
           15444]
 gi|114739528|gb|ABI77653.1| 4-hydroxybenzoate polyprenyl transferase [Hyphomonas neptunium ATCC
           15444]
          Length = 375

 Score =  142 bits (358), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 101/290 (34%), Positives = 140/290 (48%), Gaps = 8/290 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LAR     G  L  LPCL     A    R    L    + W L ++++GAIV RGA
Sbjct: 34  PYAMLARLDRPVGVWLLFLPCLMGLGFA----RLTTGLYLIDLLWTL-LFLIGAIVMRGA 88

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CTWND+ D D D++V RT +RP+PSG  T  QA +F + Q  + F++ L          
Sbjct: 89  GCTWNDITDKDFDAKVARTAARPIPSGAVTTKQAYIFLLAQLAVGFLIWLALPWDAKIAA 148

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L +  +YP++KR    PQ  LG+ F  GVFVG  A  +  + P + L  G I W + 
Sbjct: 149 LLALPLVAIYPYTKRVTWWPQAWLGLTFNWGVFVG-AATASVITGPVYILYAGLILWTIA 207

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFMVAFCLLTVNFFAWI 259
           +DT+YA QD++DD LIGV STARLF  +  L  F  + G   L    A+        A  
Sbjct: 208 YDTIYALQDREDDALIGVRSTARLFGERAVLISFGFHMGAAALIGFAAYAQGAGRLGALT 267

Query: 260 GLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQ 309
            LL  L     + + L      +  + F S    G ++ I  +I+    Q
Sbjct: 268 ALLF-LAHGAWQAMTLKTKGEGKALAMFKSNVHAGAIVAIGFLIAAMFPQ 316


>gi|186701234|gb|ACC91260.1| UbiA prenyltransferase family protein [Capsella rubella]
          Length = 407

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 143/285 (50%), Gaps = 12/285 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  LAR     G  L   PC+WS  LAA P       G    F Y+ ++  GA++ RGA 
Sbjct: 127 YAKLARLDKPIGTWLLAWPCMWSIALAADP-------GSLPSFKYMALFGCGALLLRGAG 179

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           CT NDL+D DID++V RTR RP+ SG  T FQ + F  +Q L+   +LLQ N +   +G 
Sbjct: 180 CTINDLLDQDIDTKVDRTRLRPIASGLLTPFQGIQFLGIQLLLGLGILLQLNNYSRVLGA 239

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLC--IGTIFWVV 199
           + L +   YP  KRF   PQ  LG+    G  +GW A+  S   PA  L   +  + W +
Sbjct: 240 SSLLLVFSYPLMKRFTFWPQAFLGLTINWGALLGWTAVKGSIE-PAVVLPLYLSGVCWTL 298

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
            +DT+YAHQDK+DD  +GV STA  F   TKLWL   +G   + F+    L     + + 
Sbjct: 299 VYDTIYAHQDKEDDIKVGVKSTALRFGDNTKLWL-TGFGTASMGFLALSGLSADLGWQYY 357

Query: 260 GLLIALFLTIK-RIIALDISCSKQCCSFFHSAGVVGILILICLII 303
             L A    +  +I   D+S    C   F S    G ++   +++
Sbjct: 358 ASLAAASGQLGWQIGTADLSSGADCSRKFVSNKWFGAIVFSGVVL 402


>gi|226503603|ref|NP_001148558.1| para-hydroxybenzoate--polyprenyltransferase [Zea mays]
 gi|195620420|gb|ACG32040.1| para-hydroxybenzoate--polyprenyltransferase [Zea mays]
          Length = 399

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 94/230 (40%), Positives = 122/230 (53%), Gaps = 11/230 (4%)

Query: 6   NFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFW 65
              WV D  +  A  PY  LAR     G  L   PC+WS  +AA P       G      
Sbjct: 104 QLTWV-DKWIPEAARPYAMLARLDKPIGTWLLAWPCMWSITIAAMP-------GDLPDLK 155

Query: 66  YLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLIS 125
            L ++  GA++ RGA CT NDL+D DID++V RTRSRP  SG  T  Q + F  +Q L+ 
Sbjct: 156 MLALFGCGAVLLRGAGCTVNDLLDRDIDNKVERTRSRPFASGVLTPLQGVGFLGIQLLLG 215

Query: 126 FVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW 185
             +LLQ N +   +G + L +   YP  KRF   PQ  LG+ F  G  +GW A+  S   
Sbjct: 216 LGILLQLNNYSRILGASSLVLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAIKESID- 274

Query: 186 PAFFLCIGT--IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
           PA  L + T  I W + +DT+YAHQDK+DD  +GV STA  F   TK W+
Sbjct: 275 PAIILPLYTAGICWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDLTKYWI 324


>gi|225677158|ref|ZP_03788156.1| 4-hydroxybenzoate octaprenyltransferase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590782|gb|EEH12011.1| 4-hydroxybenzoate octaprenyltransferase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 267

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 93/269 (34%), Positives = 136/269 (50%), Gaps = 7/269 (2%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R HS TG  L + P L   +LA+  L          + + L ++ +GA + R A 
Sbjct: 6   YFSLMRLHSLTGLWLVLFPSLSGILLASTSLSYQ-------VLFLLVLFTIGAFLMRPAG 58

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND+ D +ID+ V RT+ RPL SG     QAL    L   I+ V+LL  N   + +G 
Sbjct: 59  CIINDIFDREIDAHVERTKYRPLASGALNIKQALALLSLLLSIALVILLLTNKTTLILGI 118

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + +   YP  KR++  PQ+ LG  F  G  +G  A+    S  +    IG +FW + +
Sbjct: 119 ISMCMIATYPLLKRYVWWPQLFLGFTFNMGSLMGSAAITNQISIESLLFYIGCVFWTLSY 178

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT+YAHQDKKDDE +G+ STA  F   TK WL   Y I ++ ++ A  L ++N   +I L
Sbjct: 179 DTIYAHQDKKDDEKLGMKSTALYFGDTTKSWLKRFYLISLMTWLYAGILSSLNNIFYIAL 238

Query: 262 LIALFLTIKRIIALDISCSKQCCSFFHSA 290
           L   F+  ++    +     QC S F + 
Sbjct: 239 LAVGFIFHRQYKNFNPDDPSQCMSIFKNT 267


>gi|255087010|ref|XP_002505428.1| UbiA prenyltransferase domain-containing protein [Micromonas sp.
           RCC299]
 gi|226520698|gb|ACO66686.1| UbiA prenyltransferase domain-containing protein [Micromonas sp.
           RCC299]
          Length = 454

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 102/295 (34%), Positives = 134/295 (45%), Gaps = 22/295 (7%)

Query: 9   WVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLF 68
           WV + +   A+ PY  L R     G +L   PCLWS  LAA P       G     +   
Sbjct: 153 WVDETLPPFAV-PYAKLVRLDRPAGVYLLAWPCLWSIALAAPP-------GCPPDPYLSS 204

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           ++  GA + RGA CT NDL D DID  V RTR+RP+ SG  +   ALVF   Q      +
Sbjct: 205 LFCAGAFLLRGAGCTVNDLWDRDIDKLVARTRNRPIASGAVSPTAALVFLAAQLGAGAGI 264

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           LLQ N F   +G + L +   YP  KR    PQ  LG+ F  G  +G+ A+H + + PA 
Sbjct: 265 LLQLNDFSKALGASSLALVAAYPAMKRLTNWPQAFLGLTFNWGALLGYAAVHGTLN-PAV 323

Query: 189 --FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTA---------RLFSYQTKLWLFILY 237
              L    +FW + +DTVYAHQDK DD+ IGV STA         R    +  L  F   
Sbjct: 324 CAPLYASGVFWTLLYDTVYAHQDKDDDKKIGVKSTALHLQEMAGGRAEDTKKYLAAFGAA 383

Query: 238 GIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGV 292
               LC       +   F+  +    A      R + LD    + C + F S G 
Sbjct: 384 STAGLCAAGHAAGVGPAFYLGVSASAAHLAWQVRDVNLDD--GEDCAAKFRSNGT 436


>gi|297737930|emb|CBI27131.3| unnamed protein product [Vitis vinifera]
          Length = 371

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 107/290 (36%), Positives = 141/290 (48%), Gaps = 19/290 (6%)

Query: 6   NFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFW 65
           +  W+ D  +     PY  LAR     G  L   PC+WS  LAA P       G      
Sbjct: 76  DLSWI-DLYLPKQARPYARLARLDKPIGTWLLAWPCMWSITLAANP-------GHFPDIK 127

Query: 66  YLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLIS 125
            L ++  GA++ RGA CT NDL+D DID +V RT+ RP+ SG  T FQ L F   Q L+ 
Sbjct: 128 MLALFGTGALLLRGAGCTINDLLDQDIDPKVERTKLRPIASGILTPFQGLSFLGFQLLLG 187

Query: 126 FVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW 185
             +LLQ N     +G + L +   YP  KR    PQ  LG+ F  G  +GW A+  S   
Sbjct: 188 LGILLQLNNDSRILGASSLLLVFSYPLMKRLTFWPQAYLGLTFNWGALLGWSAVRGSLD- 246

Query: 186 PA--FFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
           PA  F L I  + W + +DT+YAHQDK+DD  +GV STA  F   TK W   L G  + C
Sbjct: 247 PAIVFPLYISGVCWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDSTKEW---LSGFGIAC 303

Query: 244 FMVAFCLLTVNF-FAW---IGLLIALFLTIKRIIALDISCSKQCCSFFHS 289
            + +  L   N    W   + L+ A      +I  +D+SC   C   F S
Sbjct: 304 -ISSLALSGFNADLGWPYYVALMAASGHLTWQIWTVDLSCRADCNRKFVS 352


>gi|225423769|ref|XP_002279483.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 412

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 108/298 (36%), Positives = 144/298 (48%), Gaps = 19/298 (6%)

Query: 6   NFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFW 65
           +  W+ D  +     PY  LAR     G  L   PC+WS  LAA P       G      
Sbjct: 117 DLSWI-DLYLPKQARPYARLARLDKPIGTWLLAWPCMWSITLAANP-------GHFPDIK 168

Query: 66  YLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLIS 125
            L ++  GA++ RGA CT NDL+D DID +V RT+ RP+ SG  T FQ L F   Q L+ 
Sbjct: 169 MLALFGTGALLLRGAGCTINDLLDQDIDPKVERTKLRPIASGILTPFQGLSFLGFQLLLG 228

Query: 126 FVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW 185
             +LLQ N     +G + L +   YP  KR    PQ  LG+ F  G  +GW A+  S   
Sbjct: 229 LGILLQLNNDSRILGASSLLLVFSYPLMKRLTFWPQAYLGLTFNWGALLGWSAVRGSLD- 287

Query: 186 PA--FFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
           PA  F L I  + W + +DT+YAHQDK+DD  +GV STA  F   TK W   L G  + C
Sbjct: 288 PAIVFPLYISGVCWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDSTKEW---LSGFGIAC 344

Query: 244 FMVAFCLLTVNF-FAW---IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
            + +  L   N    W   + L+ A      +I  +D+SC   C   F S    G ++
Sbjct: 345 -ISSLALSGFNADLGWPYYVALMAASGHLTWQIWTVDLSCRADCNRKFVSNKWFGAIL 401


>gi|219888303|gb|ACL54526.1| unknown [Zea mays]
          Length = 382

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 94/230 (40%), Positives = 122/230 (53%), Gaps = 11/230 (4%)

Query: 6   NFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFW 65
              WV D  +  A  PY  LAR     G  L   PC+WS  +AA P       G      
Sbjct: 104 QLTWV-DKWIPEAARPYAMLARLDKPIGTWLLAWPCMWSITIAAMP-------GDLPDLK 155

Query: 66  YLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLIS 125
            L ++  GA++ RGA CT NDL+D DID++V RTRSRP  SG  T  Q + F  +Q L+ 
Sbjct: 156 MLALFGCGAVLLRGAGCTVNDLLDRDIDNKVERTRSRPFASGVLTPLQGVGFLGIQLLLG 215

Query: 126 FVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW 185
             +LLQ N +   +G + L +   YP  KRF   PQ  LG+ F  G  +GW A+  S   
Sbjct: 216 LGILLQLNNYSRILGASSLVLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAIKESID- 274

Query: 186 PAFFLCIGT--IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
           PA  L + T  I W + +DT+YAHQDK+DD  +GV STA  F   TK W+
Sbjct: 275 PAIILPLYTAGICWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDLTKYWI 324


>gi|42521109|ref|NP_967024.1| prenyltransferase [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410850|gb|AAS14958.1| 4-hydroxybenzoate octaprenyltransferase [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 285

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 94/272 (34%), Positives = 136/272 (50%), Gaps = 7/272 (2%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R HS TG  L + P L   +LA+  L          + + L ++ +GA + R A 
Sbjct: 6   YFSLMRLHSLTGLWLVLFPSLSGILLASTSLSYQ-------VLFLLVLFTIGAFLMRPAG 58

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND+ D  ID+ V RT+ RPL SG     QAL    L   I+ V+LL  N   + +G 
Sbjct: 59  CIINDIFDRKIDAHVERTKYRPLASGALNIKQALALLSLLLSIALVILLLTNKTTLILGI 118

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + +   YP  KR++  PQ+ LG  F  G  +G  A+    S  +    IG +FW + +
Sbjct: 119 ISMCMIATYPLLKRYVWWPQLFLGFTFNMGSLMGSAAITNQISIESLLFYIGCVFWTLSY 178

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT+YAHQDKKDDE +G+ STA  F   TK WL   Y I ++ ++ A  L ++N   +I L
Sbjct: 179 DTIYAHQDKKDDEKLGMKSTALYFGDTTKSWLKRFYLISLMTWLYAGILSSLNNIFYIAL 238

Query: 262 LIALFLTIKRIIALDISCSKQCCSFFHSAGVV 293
           L   F+  ++    +     QC S F +   V
Sbjct: 239 LAVGFIFHRQYKNFNPDDPSQCMSIFKNNSYV 270


>gi|242024183|ref|XP_002432509.1| para-hydroxybenzoate polyprenyltransferase, putative [Pediculus
           humanus corporis]
 gi|212517947|gb|EEB19771.1| para-hydroxybenzoate polyprenyltransferase, putative [Pediculus
           humanus corporis]
          Length = 379

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 149/291 (51%), Gaps = 8/291 (2%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
             I PY+ L R H   G  L   PC WS  +AA      G L   ++   L ++  GA++
Sbjct: 87  EKIKPYLKLMRLHQPAGSWLLFWPCSWSIGMAA----ENGELPNLSM---LALFGAGALI 139

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT NDL D DIDS+V RT +RPL +GQ T+F+ALVF   Q  IS ++LLQ N + 
Sbjct: 140 MRGAGCTINDLWDKDIDSKVSRTSNRPLVTGQVTKFKALVFLGGQLSISLLILLQLNWYS 199

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP-AFFLCIGTI 195
           + +G + L + + YP  KR    PQ++LG  F  G  +GW A+H S  W     L +  I
Sbjct: 200 VFLGASSLLLVITYPLMKRITYWPQLILGCTFNWGALLGWSAVHGSCDWSICLPLYLSGI 259

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W +++DT+YA+QD  DD  +G+ STA  F    K +L     I +   ++A    +  F
Sbjct: 260 SWTLFYDTIYAYQDVVDDLSLGIKSTAIKFGSDAKYYLSAFATIMISSLLLAGYNSSQTF 319

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
             +  +  A      ++  LDI     C   F S   +G +I   +++  F
Sbjct: 320 CYYFSVAAAATHLGLQVKTLDIDQPIDCWKKFISNRYLGGIIFAGIVLGTF 370


>gi|297799624|ref|XP_002867696.1| ATPPT1 [Arabidopsis lyrata subsp. lyrata]
 gi|297313532|gb|EFH43955.1| ATPPT1 [Arabidopsis lyrata subsp. lyrata]
          Length = 405

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 105/295 (35%), Positives = 145/295 (49%), Gaps = 12/295 (4%)

Query: 12  DCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYI 71
           D  +   +  Y  LAR     G  L   PC+WS  LAA P       G    F Y+ ++ 
Sbjct: 115 DLYLPEEVRGYAKLARLDKPIGTWLLAWPCMWSIALAADP-------GSLPSFKYMALFG 167

Query: 72  VGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQ 131
            GA++ RGA CT NDL+D DID +V RTR RP+ SG  T FQ + F  LQ L+   +LLQ
Sbjct: 168 CGALLLRGAGCTINDLLDQDIDPKVDRTRLRPIASGLLTPFQGIGFLGLQLLLGLGILLQ 227

Query: 132 FNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLC 191
            N +   +G + L +   YP  KRF   PQ  LG+    G  +GW A+  S   PA  L 
Sbjct: 228 LNNYSRVLGASSLLLVFSYPLMKRFTFWPQAFLGLTINWGALLGWTAVKGSID-PAVVLP 286

Query: 192 --IGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFC 249
             +  + W + +DT+YAHQDK+DD  +GV STA  F   TKLWL   +G   + F+    
Sbjct: 287 LYLSGVCWTLVYDTIYAHQDKEDDVKVGVKSTALRFGDNTKLWL-TGFGTASMGFLALSG 345

Query: 250 LLTVNFFAWIGLLIALFLTIK-RIIALDISCSKQCCSFFHSAGVVGILILICLII 303
           L     + +   L A    +  +I   D+S    C   F S    G +I   +++
Sbjct: 346 LSADLGWQYYASLAAASGQLGWQIGTADLSSGADCSRKFVSNKWFGAIIFSGVVL 400


>gi|144899420|emb|CAM76284.1| UbiA prenyltransferase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 304

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 137/288 (47%), Gaps = 11/288 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFI-YIVGAIVTRG 79
           PY+ L R     G  L + PC WS  LA          GW    W L I +  G+++ RG
Sbjct: 27  PYLRLMRLDRPIGTWLLLFPCWWSIALAGE--------GWPD--WRLMILFAAGSVIMRG 76

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICV 139
           A CT ND+ DH  D+ V RT+ RP+PSG  +  QA +F V Q L   V+L Q N   I  
Sbjct: 77  AGCTINDMADHKFDALVERTKGRPIPSGAVSVTQAGLFLVAQLLAGLVILTQLNAAAIWW 136

Query: 140 GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVV 199
           G A L +   YP  KR    PQ  LG+ F  G  +GW A+    +     L    I W +
Sbjct: 137 GAASLALVFPYPLMKRITWWPQAWLGLTFNWGALLGWVAVTGQMAAAPLLLYAAGILWTL 196

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
            +DT+YAHQDK DD+LIGV STA      T   L   Y   V+    A     +++  ++
Sbjct: 197 GYDTIYAHQDKDDDQLIGVKSTALRLGAHTGPALAGFYAGAVVLMAAAGVAAHLSWPFYL 256

Query: 260 GLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
            LL++      ++ +L +  +  C + F S  + G  +L  +I    L
Sbjct: 257 LLLLSAGQLAWQVRSLRMDDAADCLAKFKSNRLFGWGLLAAIIAGKVL 304


>gi|325185879|emb|CCA20385.1| parahydroxybenzoatepolyprenyltransferase putative [Albugo laibachii
           Nc14]
          Length = 352

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 93/278 (33%), Positives = 136/278 (48%), Gaps = 8/278 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PYV LAR +   G  +   PC+WS  LAA        +G    F  L ++ +G+++ R A
Sbjct: 71  PYVQLARINRPAGTFMLFWPCVWSISLAA-------PIGQLPDFKLLSLFGIGSLLMRSA 123

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT ND+ D   D  V RT  RPL +G  T  QA  F  +Q      +LLQ N + + +G
Sbjct: 124 GCTINDMWDRKYDRLVERTNQRPLAAGTITYEQAWGFLAVQLCGGLAVLLQLNWYSVALG 183

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP-AFFLCIGTIFWVV 199
            + L + + YP  KR    PQ  LG+ F  G  +GW A+H S +WP    L +  + W +
Sbjct: 184 ASSLGLVIAYPLVKRVTYWPQAFLGLTFNYGAILGWAAVHGSTNWPIVLPLYVSGVCWTL 243

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
            +DT+YAHQD+ DD  IGV STA LF  +T   L     + V C   A  L  + +  ++
Sbjct: 244 VYDTLYAHQDRNDDMAIGVRSTAILFGDKTIPILNAFAALSVSCLGAAGYLSELAWPFYV 303

Query: 260 GLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
           GL         +I    ++ ++   + F S    G +I
Sbjct: 304 GLGAGAGQLAWQINTAKLNDAENLQTRFRSNKYFGAII 341


>gi|291612782|ref|YP_003522939.1| 4-hydroxybenzoate polyprenyl transferase [Sideroxydans
           lithotrophicus ES-1]
 gi|291582894|gb|ADE10552.1| 4-hydroxybenzoate polyprenyl transferase [Sideroxydans
           lithotrophicus ES-1]
          Length = 296

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 92/282 (32%), Positives = 140/282 (49%), Gaps = 18/282 (6%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L R H   G  L + P LW+  +A       G   W  +F    I+ +G ++ R + 
Sbjct: 19  YIQLTRLHRPIGILLLLWPTLWAVWIAG-----NGHPSWLIVF----IFTLGTVLMRSSG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  ID  V RT+ RPL SG+ +  +AL  A++  L SF L+L  NP    + F
Sbjct: 70  CAVNDYADRHIDKHVKRTQDRPLTSGKISEREALWVAIVLALASFALILPLNPLTWLLAF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             +F++  YPF+KRF   PQ  LGI F  G+ + + A   S    A+ L +  IFW V +
Sbjct: 130 PAVFLAASYPFTKRFFAIPQAYLGIAFGFGIPMAFAATLGSVPPVAWVLLLANIFWAVAY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  +G++S+A  F     + + I Y   +L   +A  +  +  F ++GL
Sbjct: 190 DTEYAMVDRDDDIHLGIHSSALFFGKYDVVAVMICYLTTLLLLAIAGLMAGLGLFYFLGL 249

Query: 262 LIALFLTIKRIIALDISCSKQC-CSFFHS--------AGVVG 294
           ++A F+       +     K+C  +F H+        AGVVG
Sbjct: 250 IVAEFIAFHHYRLIRDRDRKKCFAAFLHNNWFGAAVFAGVVG 291


>gi|304319958|ref|YP_003853601.1| 4-hydroxybenzoate octaprenyltransferase [Parvularcula bermudensis
           HTCC2503]
 gi|303298861|gb|ADM08460.1| 4-hydroxybenzoate octaprenyltransferase [Parvularcula bermudensis
           HTCC2503]
          Length = 309

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 86/236 (36%), Positives = 121/236 (51%), Gaps = 7/236 (2%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           + + PY  L R     G  L   PCLW T++      R   +    I+    ++++G++ 
Sbjct: 28  AGMRPYFRLMRADRPVGLWLLFWPCLWGTLIG-----RPDDMTAPEIYRLWALFLIGSVA 82

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C +ND+VD DID+QV RT SRPLPSGQ    +A V  V   L+   +LL      
Sbjct: 83  MRSAGCIYNDIVDRDIDAQVARTASRPLPSGQVRVSEAWVLLVALCLVGLTVLLSLPLPA 142

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I +G   L +   YPF KR    PQ  LG+ F  GV VG  A+    S P        +F
Sbjct: 143 ILIGLCALVLVAAYPFMKRITWWPQAWLGLTFNWGVLVGGAAVAGGLSGPILCAYAAGLF 202

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLT 252
           W + +DT+YA QD +DD LIGV S+AR         + + YG+ V+  ++AF LL+
Sbjct: 203 WTLGYDTIYALQDVEDDALIGVKSSARALGDSAVTGVAVFYGLCVI--LMAFALLS 256


>gi|224013626|ref|XP_002296477.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220968829|gb|EED87173.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 299

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 98/299 (32%), Positives = 141/299 (47%), Gaps = 15/299 (5%)

Query: 15  MGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGA 74
           +  ++ PY +L+R     G  L + PCLWST LA  PL     L    +F        G+
Sbjct: 2   LSKSLHPYAHLSRLDKPIGTFLLLHPCLWSTALATTPLGSPPDLALCALF------ATGS 55

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
            + RGA CT ND+ D   D  V RTR RPL SG  T  QA  F  LQ      +LL    
Sbjct: 56  FIMRGAGCTINDMWDSKYDKNVERTRDRPLASGALTYPQAWKFLALQMSAGLGVLLSLPH 115

Query: 135 FVICV--GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LC 191
              C   G A L +   YP  KR+   PQ+VLG+ F  G  +GW A+     W     L 
Sbjct: 116 LEQCFKWGVASLPLVATYPLMKRYTNYPQLVLGLTFNWGAIMGWVAVRGDVDWSVVGPLY 175

Query: 192 IGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQ-TKLWLFILYGIFVLCFMVA--- 247
              + W + +DT+YAHQDK DD+ +G+ STA  F  + TK  L  L G+    +M+A   
Sbjct: 176 ASGVAWTLIYDTLYAHQDKSDDKKLGLKSTALTFGEEGTKPILTTLAGVTWGGWMLAGYN 235

Query: 248 --FCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
             F  + V  + + G   A    + +I + D++ ++     F S  +VG ++    ++ 
Sbjct: 236 CGFGDVLVYPYYYAGCTAAASHLLWQIQSADLNSAENLSYRFRSNNLVGAVVFASCVVG 294


>gi|115475886|ref|NP_001061539.1| Os08g0322600 [Oryza sativa Japonica Group]
 gi|38637096|dbj|BAD03352.1| putative PGT-2 [Oryza sativa Japonica Group]
 gi|109627622|dbj|BAE96574.1| p-hydroxybenzoate polyprenyltransferase [Oryza sativa Japonica
           Group]
 gi|113623508|dbj|BAF23453.1| Os08g0322600 [Oryza sativa Japonica Group]
          Length = 418

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 95/227 (41%), Positives = 122/227 (53%), Gaps = 11/227 (4%)

Query: 9   WVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLF 68
           WV D  +  A  PY  LAR     G  L   PC WS  +AA P       G       L 
Sbjct: 126 WV-DRWLPQAARPYAMLARLDKPIGTWLLAWPCFWSISMAAMP-------GELPDMRMLA 177

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           ++  GA++ RGA CT NDL+D DID++V RT+SRP  SG  T  Q + F  LQ L+   +
Sbjct: 178 LFGCGAVLLRGAGCTVNDLLDRDIDNKVERTKSRPFASGILTPTQGVGFLGLQLLLGLGI 237

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           LLQ N +   +G + LF+   YP  KRF   PQ  LG+ F  G  +GW A+  S   PA 
Sbjct: 238 LLQLNNYSRILGASSLFLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAIKESLD-PAI 296

Query: 189 FLCIGT--IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
            L + T  I W + +DT+YAHQDK+DD  +GV STA  F   TK W+
Sbjct: 297 ILPLYTAGICWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDLTKHWI 343


>gi|225631016|ref|YP_002727807.1| 4-hydroxybenzoate octaprenyltransferase [Wolbachia sp. wRi]
 gi|13569581|gb|AAK31155.1|AF348330_1 4-hydroxybenzoate octaprenyltransferase [Wolbachia sp. wRi]
 gi|225592997|gb|ACN96016.1| 4-hydroxybenzoate octaprenyltransferase [Wolbachia sp. wRi]
          Length = 285

 Score =  140 bits (353), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 94/272 (34%), Positives = 136/272 (50%), Gaps = 7/272 (2%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R HS TG  L + P L   +LA+  L    +       + L ++ +GA + R A 
Sbjct: 6   YFSLMRLHSLTGLWLVLFPSLSGILLASTSLSYQAL-------FLLVLFTIGAFLMRPAG 58

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND+ D  ID+ V RT+ RPL SG     QAL    L   I+ V+LL  N   + +G 
Sbjct: 59  CIINDIFDRKIDAHVERTKYRPLASGALNIKQALALLSLLLSIALVILLLTNKTTLILGI 118

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + +   YP  KR++  PQ+ LG  F  G  +G  A+    S  +    IG +FW + +
Sbjct: 119 ISMCMIATYPLLKRYVWWPQLFLGFTFNMGSLMGSAAITNQISIESLLFYIGCVFWTLSY 178

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT+YAHQDKKDDE +G+ STA  F   TK WL   Y I ++ ++ A  L ++N   +I L
Sbjct: 179 DTIYAHQDKKDDEKLGMKSTALYFGDTTKSWLKRFYLISLMTWLYAGILSSLNNIFYIAL 238

Query: 262 LIALFLTIKRIIALDISCSKQCCSFFHSAGVV 293
           L   F+  ++    +     QC S F +   V
Sbjct: 239 LAVGFIFHRQCKNFNPDDPSQCMSIFKNNSYV 270


>gi|222640342|gb|EEE68474.1| hypothetical protein OsJ_26876 [Oryza sativa Japonica Group]
          Length = 421

 Score =  140 bits (352), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 95/227 (41%), Positives = 122/227 (53%), Gaps = 11/227 (4%)

Query: 9   WVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLF 68
           WV D  +  A  PY  LAR     G  L   PC WS  +AA P       G       L 
Sbjct: 126 WV-DRWLPQAARPYAMLARLDKPIGTWLLAWPCFWSISMAAMP-------GELPDMRMLA 177

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           ++  GA++ RGA CT NDL+D DID++V RT+SRP  SG  T  Q + F  LQ L+   +
Sbjct: 178 LFGCGAVLLRGAGCTVNDLLDRDIDNKVERTKSRPFASGILTPTQGVGFLGLQLLLGLGI 237

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           LLQ N +   +G + LF+   YP  KRF   PQ  LG+ F  G  +GW A+  S   PA 
Sbjct: 238 LLQLNNYSRILGASSLFLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAIKESLD-PAI 296

Query: 189 FLCIGT--IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
            L + T  I W + +DT+YAHQDK+DD  +GV STA  F   TK W+
Sbjct: 297 ILPLYTAGICWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDLTKHWI 343


>gi|307215250|gb|EFN90004.1| Para-hydroxybenzoate--polyprenyltransferase, mitochondrial
           [Harpegnathos saltator]
          Length = 300

 Score =  139 bits (351), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 93/274 (33%), Positives = 142/274 (51%), Gaps = 12/274 (4%)

Query: 40  PCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRT 99
           P  WS  +AA     AG L      + L ++  GA + RGA CT ND+ D DID  V RT
Sbjct: 18  PSGWSIAMAA----SAGAL---PDLYTLALFGTGAFIMRGAGCTINDMWDQDIDKMVART 70

Query: 100 RSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILC 159
           + RPL SGQ T  Q+ +F   Q  +  ++LLQ N + I +G + L + ++YP  KR    
Sbjct: 71  KDRPLVSGQITLEQSFIFLAGQLSLGLLVLLQLNWYSIFLGASSLGLVIIYPLMKRITYW 130

Query: 160 PQVVLGIGFAGGVFVGWGALHASFSWP-AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGV 218
           PQ++LG+ F  G  +GW A+  S  W     + IG I W + +DT+YAHQD+ DD L+G+
Sbjct: 131 PQLILGMAFNWGALLGWSAVRGSCDWSICLPMYIGGICWTIVYDTIYAHQDRTDDILLGI 190

Query: 219 NSTARLFSYQTKLWLFILYGIFVLCFMVAFCLL--TVNFFAWIGLLIALFLTIKRIIALD 276
            STA  F   TK +L       +  F+ +  L   T  ++  +G+L A      +I  L+
Sbjct: 191 KSTAIKFGNDTKFYLSGFAVAMLASFVTSGILAAQTWPYYTAVGVLAAHI--SNQIYTLN 248

Query: 277 ISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
           ++    C   F S   VG+++   +++   +  F
Sbjct: 249 VNNPADCAKKFTSNHRVGMILFAGIVLGNLMKNF 282


>gi|326404265|ref|YP_004284347.1| putative 4-hydroxybenzoate polyprenyl transferase [Acidiphilium
           multivorum AIU301]
 gi|325051127|dbj|BAJ81465.1| putative 4-hydroxybenzoate polyprenyl transferase [Acidiphilium
           multivorum AIU301]
          Length = 309

 Score =  139 bits (351), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 148/284 (52%), Gaps = 8/284 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           P+  LAR     G  L  LP LWS +LA     RAGV  W+T+   + ++ VGA+V R A
Sbjct: 33  PFALLARLDRPIGVWLLFLPGLWSILLA-----RAGV--WTTLG-LIALFAVGAVVMRAA 84

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C  NDL D ++D QV RT  RPL SG  +   A+ F +L  L   V+LL        +G
Sbjct: 85  GCVVNDLWDRELDRQVARTAGRPLASGAVSVPAAVAFLLLLLLAGLVILLMLGRTAQILG 144

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L +   YP +KR    PQV+LG  F  G  +G+ A H +  WP   L  GTI W++ 
Sbjct: 145 VASLVLVAFYPAAKRVTWWPQVMLGFTFGWGAPLGYAAAHGALGWPVLPLYAGTILWILG 204

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQD++DD L G+ S+A     +T+L++ + Y   +     A  +  +     I 
Sbjct: 205 YDTIYAHQDREDDALAGIKSSALRLGGRTRLFVALWYAGMLALIAAAMAVAGIGRDGLIA 264

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           L +   L   +++ LDI    +C + F     VG+L+ + ++I 
Sbjct: 265 LALPGALLAWQVVRLDIDDPARCLALFKLNRWVGLLVGLAILIG 308


>gi|156972620|ref|YP_001443527.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio harveyi ATCC
           BAA-1116]
 gi|167011559|sp|A7N0X0|UBIA_VIBHB RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|156524214|gb|ABU69300.1| hypothetical protein VIBHAR_00272 [Vibrio harveyi ATCC BAA-1116]
          Length = 284

 Score =  139 bits (351), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 90/288 (31%), Positives = 145/288 (50%), Gaps = 19/288 (6%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P +W+ V+AA      G+  W+     L ++++G  + R A 
Sbjct: 9   YWQLMRMDRPIGSLLLLWPTVWALVIAA-----QGMPSWNV----LIVFVLGVFLMRSAG 59

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT+ RPLPSG+ T  +A+   ++  + SF+L+L  NP  I + F
Sbjct: 60  CVINDFADRKVDGHVKRTKQRPLPSGKVTSKEAIGLFLVLGISSFLLVLTMNPLTIKLSF 119

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A +F++ +YPF KR+   PQ+ LG+ F+  + + W A      W  +F+ +    W + +
Sbjct: 120 AGIFLAFIYPFMKRYTYLPQLFLGLAFSWAIPMAWAAQTGELPWIVWFVFVINALWTIAY 179

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF-----F 256
           DT YA  D+ DD  IG+ STA LF    KL    + G+  L  +    LL  ++     +
Sbjct: 180 DTQYAMVDRDDDLKIGIKSTAILFGRHDKL----VIGVLQLVTLAMLVLLGQHYELGQSY 235

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            W  +L+A  L + +   +       C   F +   VGI+I+I L+I+
Sbjct: 236 YWT-ILVAASLFVYQQHLIRHRERDLCFKAFLNNNYVGIVIVIGLLIA 282


>gi|268573678|ref|XP_002641816.1| C. briggsae CBR-COQ-2 protein [Caenorhabditis briggsae]
          Length = 310

 Score =  139 bits (351), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 98/295 (33%), Positives = 144/295 (48%), Gaps = 10/295 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S I PY+ L R     G  L   PC WS  +A      AG L      + L ++  GA +
Sbjct: 21  SNIKPYLQLMRVDKPIGTWLLYWPCTWSIAMAT----PAGQL---PSLYMLSLFGTGAFL 73

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  NDL D D D QV RT+ RPL  G  +  QA+         S  +LLQ N F 
Sbjct: 74  MRSAGCVINDLWDKDFDKQVERTKLRPLACGLLSEKQAVGLLAGLLSSSLAILLQLNWFS 133

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTI 195
           + VG + + + + YP +KR+   PQ +LG+ F  G  +GW AL    S  A F++    +
Sbjct: 134 VAVGASSMALVVGYPLAKRYTYWPQFMLGLTFNWGALLGWAALKGDLSSSAPFWMYAAAL 193

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT+YAHQDK DD +IGV STA      TK WL   +G+  +  + A  + +   
Sbjct: 194 QWTLVYDTIYAHQDKADDIMIGVKSTALRLGADTKKWLSA-FGVGTVASLTACGMASDQT 252

Query: 256 FAWIGLLIALFLTIK-RIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQ 309
           + +   L A    +  +I ++DI     C   F S   +GI++   +++S  L +
Sbjct: 253 WPYYVALAATTAQLGWQIGSVDIDNGADCWDKFKSNSWMGIILFTGIVMSTLLKE 307


>gi|190571747|ref|YP_001976105.1| 4-hydroxybenzoate octaprenyltransferase [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|213019231|ref|ZP_03335038.1| 4-hydroxybenzoate octaprenyltransferase [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
 gi|190358019|emb|CAQ55488.1| 4-hydroxybenzoate octaprenyltransferase [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|212995340|gb|EEB55981.1| 4-hydroxybenzoate octaprenyltransferase [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
          Length = 295

 Score =  139 bits (351), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 93/268 (34%), Positives = 137/268 (51%), Gaps = 7/268 (2%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R HS TG  L +   L   +LA+  L    +       + L ++ +GA + R A 
Sbjct: 6   YFSLMRIHSLTGLWLVLFSSLSGILLASTSLSYQAL-------FLLVLFTIGAFLMRPAG 58

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND+ D +ID+ V RT+ RPL SG     QAL    L   I+ V+LL  N   + +G 
Sbjct: 59  CIINDIFDREIDAHVERTKYRPLASGALNIKQALALLSLLLSIALVILLLTNKTTLILGI 118

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + + ++YP  KR++  PQ+ LG  F  G  +G  A+    S  +    IG +FW + +
Sbjct: 119 ISMCMIVIYPLLKRYVWWPQLFLGFTFNMGSLMGSAAITNQISIESLLFYIGCVFWTLSY 178

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT+YAHQDKKDDE +G+ STA  F   TK WL   Y I ++ ++ A  L ++N   +I L
Sbjct: 179 DTIYAHQDKKDDEKLGMKSTALYFGNTTKSWLKRFYLISLMAWLYAGILSSLNNIFYIAL 238

Query: 262 LIALFLTIKRIIALDISCSKQCCSFFHS 289
           L   F+   +    +   S QC S F +
Sbjct: 239 LAIGFIFHHQHKNFNPDDSNQCMSIFKN 266


>gi|330429979|gb|AEC21313.1| 4-hydroxybenzoate octaprenyltransferase [Pusillimonas sp. T7-7]
          Length = 318

 Score =  139 bits (350), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 151/293 (51%), Gaps = 13/293 (4%)

Query: 20  APYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRG 79
            PY  L R     G  L +LPCL + V AA         GW T+F  LFI+ +GA++ RG
Sbjct: 34  GPYARLCRLDRPVGTWLTLLPCLAALVQAAD--------GWPTLF-RLFIFSLGALLMRG 84

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICV 139
             C +ND+ D DID +V RTR RPL SGQ +   AL F + Q  +  +LLL  N +   +
Sbjct: 85  IGCCFNDIFDRDIDQKVERTRFRPLTSGQLSLKNALWFVLAQLAVCALLLLALNEYSRWL 144

Query: 140 GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVV 199
             ALL I ++YP  KRF   PQVVLGIGF  G+ + W          A  + +G + W V
Sbjct: 145 AVALLPIVIVYPLCKRFTYWPQVVLGIGFNWGMLMAWSDTQNIVPAGAIAMWVGAVLWQV 204

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVNFFA 257
            +D++YA+ D +DD  +G+ STA  F+ + K+W+  F +  I +  +  A   +   ++ 
Sbjct: 205 GYDSIYAYVDVRDDIKLGLRSTALRFADKGKIWISGFYIVTIALWVYGGAAMGMAWPYYV 264

Query: 258 WIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
            I  + A F    ++    ++   +    F +   VG+L+L+  +    L QF
Sbjct: 265 VIAAIAAHFFW--QMCVFSLARPDRNFMLFRANMAVGVLLLVAALAGTVLRQF 315


>gi|294464339|gb|ADE77682.1| unknown [Picea sitchensis]
          Length = 369

 Score =  139 bits (350), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 126/249 (50%), Gaps = 14/249 (5%)

Query: 12  DCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYI 71
           D  +   + PY +LAR     G  L   PC+WS  LAA P     V         L ++ 
Sbjct: 125 DLYLPKRLRPYAHLARLDKPIGTWLLAWPCMWSIALAAPPGNLPDVK-------MLSLFG 177

Query: 72  VGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQ 131
           +GA++ RG+ CT NDL+D DID +V RT+ RP+  G  T FQ L F   Q L+   +LLQ
Sbjct: 178 LGALLLRGSGCTVNDLLDRDIDQKVQRTKLRPIACGALTPFQGLCFLGFQLLLGLGVLLQ 237

Query: 132 FNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-L 190
            N F   +G + L +   YP  KRF   PQ  LG+ F  G  +GW A+  +        L
Sbjct: 238 LNNFSRILGASSLLLVASYPLMKRFTFWPQAYLGLTFNWGALLGWAAVKGNLDLTVVLPL 297

Query: 191 CIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCL 250
               I W + +DT+YAHQDK+DD  +G+ STA  F  QT++W   L G  V C     CL
Sbjct: 298 YASGICWTLVYDTIYAHQDKEDDLKVGIKSTALRFGDQTQIW---LSGFGVACIS---CL 351

Query: 251 LTVNFFAWI 259
               F A I
Sbjct: 352 TLSGFNAAI 360


>gi|18416190|ref|NP_567688.1| AtPPT1 (Arabidopsis thaliana polyprenyltransferase 1);
           4-hydroxybenzoate nonaprenyltransferase
 gi|30686272|ref|NP_849431.1| AtPPT1 (Arabidopsis thaliana polyprenyltransferase 1);
           4-hydroxybenzoate nonaprenyltransferase
 gi|75163642|sp|Q93YP7|4HPT_ARATH RecName: Full=4-hydroxybenzoate polyprenyltransferase,
           mitochondrial; Short=4HPT; AltName:
           Full=4-hydroxybenzoate nonaprenyltransferase; AltName:
           Full=Polyprenyltransferase 1; Short=AtPPT1; Flags:
           Precursor
 gi|16648989|gb|AAL24346.1| polyprenyltransferase like protein [Arabidopsis thaliana]
 gi|30314685|dbj|BAB20818.2| para-hydroxy bezoate polyprenyl diphosphate transferase
           [Arabidopsis thaliana]
 gi|30725666|gb|AAP37855.1| At4g23660 [Arabidopsis thaliana]
          Length = 407

 Score =  138 bits (348), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 122/224 (54%), Gaps = 10/224 (4%)

Query: 12  DCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYI 71
           D  +   +  Y  LAR     G  L   PC+WS  LAA P       G    F Y+ ++ 
Sbjct: 117 DLYLPEEVRGYAKLARLDKPIGTWLLAWPCMWSIALAADP-------GSLPSFKYMALFG 169

Query: 72  VGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQ 131
            GA++ RGA CT NDL+D DID++V RT+ RP+ SG  T FQ + F  LQ L+   +LLQ
Sbjct: 170 CGALLLRGAGCTINDLLDQDIDTKVDRTKLRPIASGLLTPFQGIGFLGLQLLLGLGILLQ 229

Query: 132 FNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLC 191
            N +   +G + L +   YP  KRF   PQ  LG+    G  +GW A+  S + P+  L 
Sbjct: 230 LNNYSRVLGASSLLLVFSYPLMKRFTFWPQAFLGLTINWGALLGWTAVKGSIA-PSIVLP 288

Query: 192 --IGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
             +  + W + +DT+YAHQDK+DD  +GV STA  F   TKLWL
Sbjct: 289 LYLSGVCWTLVYDTIYAHQDKEDDVKVGVKSTALRFGDNTKLWL 332


>gi|148260871|ref|YP_001234998.1| 4-hydroxybenzoate polyprenyl transferase [Acidiphilium cryptum
           JF-5]
 gi|146402552|gb|ABQ31079.1| 4-hydroxybenzoate octaprenyltransferase [Acidiphilium cryptum JF-5]
          Length = 286

 Score =  138 bits (348), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 148/284 (52%), Gaps = 8/284 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           P+  LAR     G  L  LP LWS +LA     RAGV  W+T+   + ++ VGA+V R A
Sbjct: 10  PFALLARLDRPIGVWLLFLPGLWSILLA-----RAGV--WTTLG-LIALFAVGAVVMRAA 61

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C  NDL D ++D +V RT  RPL SG  +   A+ F +L  L   V+LL        +G
Sbjct: 62  GCVVNDLWDRELDRKVARTAGRPLASGAVSVPAAVAFLLLLLLAGLVILLMLGRTAQILG 121

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L +   YP +KR    PQV+LG  F  G  +G+ A H +  WP   L  GTI W++ 
Sbjct: 122 VASLVLVAFYPAAKRVTWWPQVMLGFTFGWGAPLGYAAAHGALGWPVLPLYAGTILWILG 181

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YAHQD++DD L G+ S+A     +T+L++ + Y   +     A  +  +     I 
Sbjct: 182 YDTIYAHQDREDDALAGIKSSALRLGGRTRLFVALWYAGMLALIAAAMAVAGIGRDGLIA 241

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           L +   L   +++ LDI    +C + F     VG+L+ + ++I 
Sbjct: 242 LALPGALLAWQVVRLDIDDPARCLALFKLNRWVGLLVGLAILIG 285


>gi|189184302|ref|YP_001938087.1| 4-hydroxybenzoate polyprenyltransferase [Orientia tsutsugamushi
           str. Ikeda]
 gi|189181073|dbj|BAG40853.1| 4-hydroxybenzoate octaprenyltransferase [Orientia tsutsugamushi
           str. Ikeda]
          Length = 291

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/285 (31%), Positives = 150/285 (52%), Gaps = 13/285 (4%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           + L+R ++  G  L   PC +   L +    +         +  L I+ +G+I+ R   C
Sbjct: 15  IKLSRLNNPVGIFLLFFPCCFGIGLVSLEQVK---------YNSLVIFFIGSILMRSFGC 65

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFA 142
             ND+VD DIDS+V RT+ RPL + Q T   A+++ ++  L + +LL+Q +   I +   
Sbjct: 66  IVNDIVDKDIDSRVARTKLRPLANNQITVTSAVIYLIVISLAALMLLIQLSDLAIILAIL 125

Query: 143 LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFD 202
              +  +YPF KR    PQV+LGI F  G  + +  +  + +  +  + IG IFW + +D
Sbjct: 126 ASTLIFIYPFMKRLTYYPQVILGITFNSGALISYANITNNLTIASVVMYIGCIFWTIGYD 185

Query: 203 TVYAHQDKKDDELIGVNSTAR-LFSYQTKLWLFI-LYGIFVLCFMVAFCL--LTVNFFAW 258
           T+YA  D  DDE I V S A  L + + KLW+   LY IF+  F+ +  L    ++ FA 
Sbjct: 186 TIYAFADAGDDEKIKVKSLALVLKNNKYKLWILASLYLIFISMFVESILLSAFKLSIFAV 245

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLII 303
           + ++ A  L + +I  LD++    C + F +  +VG+L+ I +I+
Sbjct: 246 LFIVAATCLLMWQIATLDVTQPLNCLTRFKANTIVGLLLFIAMIL 290


>gi|299746982|ref|XP_001839404.2| prenyltransferase [Coprinopsis cinerea okayama7#130]
 gi|298407312|gb|EAU82418.2| prenyltransferase [Coprinopsis cinerea okayama7#130]
          Length = 333

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 106/303 (34%), Positives = 144/303 (47%), Gaps = 13/303 (4%)

Query: 14  IMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVG 73
           ++G  IAPYV L R     G  L   P  WS  +AA  L  +    +S+   Y F++   
Sbjct: 35  LLGHDIAPYVQLTRIQKYGGVLLLWWPFAWSLTIAATTLNLS-FFEFSSGLLYSFVF--- 90

Query: 74  AIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFN 133
           A + R A C WND++D D D QV RT++RPL SG+ T   ALVF ++  +    +L   N
Sbjct: 91  ANLLRSAGCIWNDILDRDFDRQVERTKNRPLASGRATVKGALVFLLMHLVFLVAMLHPLN 150

Query: 134 PFVICVGF-ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI 192
            F   VGF A+ F   LYP  KR    PQ  LG+    GV + W A+      PA     
Sbjct: 151 QFARIVGFFAIFFFPGLYPLMKRITYWPQAWLGLTMNIGVPLTWAAISGECPTPALVFYA 210

Query: 193 GTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLT 252
           GT  W +++DT+YA QDKKDD   G+ STA LF   TK+ L     I   CF VA  L  
Sbjct: 211 GTWAWCIWYDTIYACQDKKDDVNAGIKSTAVLFDSYTKVILAFFGMITFGCFSVAGYL-- 268

Query: 253 VNFFAWIGLLIALFLTIKRI----IALDISCSKQCCSFFHS-AGVVGILILICLIISLFL 307
            N   W   ++ +   +         +D+   K C   F S A   G +I   L+I   +
Sbjct: 269 -NGSHWTYYVVTVLGGMAHFGWQWSKVDLDSPKSCWKMFTSNAFSFGYVIWTGLLIEYIM 327

Query: 308 DQF 310
             +
Sbjct: 328 TAY 330


>gi|241667229|ref|ZP_04754807.1| prenyltransferase [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|254875780|ref|ZP_05248490.1| prenyltransferase [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|254841801|gb|EET20215.1| prenyltransferase [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
          Length = 285

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 86/289 (29%), Positives = 144/289 (49%), Gaps = 9/289 (3%)

Query: 16  GSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAI 75
            +    Y+ L R H      L + P L + VLA++ +             YL I+ +G +
Sbjct: 4   NTKFKAYIMLMRLHRPIPILLILWPTLTALVLASHGIPDIK---------YLIIFTIGVV 54

Query: 76  VTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPF 135
           V R   C  ND+ D D D  V RT +RPL SG+ +   AL   +   +++F+ +L  N +
Sbjct: 55  VMRTVGCIVNDIADIDFDKHVERTNTRPLTSGKLSVKNALYLCLALTIVAFICVLFLNLY 114

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTI 195
            I + F  LF+++LYPF KRF   PQ++LG+ F  G+F+ + A+       A+   + TI
Sbjct: 115 TILLSFVALFLAVLYPFCKRFFAIPQLILGLAFNFGIFMAFSAIENQIPLEAWIFYLSTI 174

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT+YA  D+  D  IG+ S+A LF  +   ++F+   I ++  +     L+ N 
Sbjct: 175 CWTIAYDTIYALADRDFDLEIGIKSSAVLFGDKVFKYIFLFNFISLILLITLGIYLSFNI 234

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
             +IG++I+ FL I+            C   F     +G++I I ++I 
Sbjct: 235 IFYIGVVISAFLFIRNYFLYKKLGIANCIKAFSDNHWIGLIIFIVVVIQ 283


>gi|218200938|gb|EEC83365.1| hypothetical protein OsI_28774 [Oryza sativa Indica Group]
          Length = 421

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 94/227 (41%), Positives = 121/227 (53%), Gaps = 11/227 (4%)

Query: 9   WVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLF 68
           WV D  +  A  PY  LAR     G  L   PC WS  +AA P       G       L 
Sbjct: 126 WV-DRWLPQAARPYAMLARLDKPIGTWLLAWPCFWSISMAAMP-------GELPDMRMLA 177

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           ++  GA++ RGA CT NDL+D DID++V RT+SRP  SG  T  Q + F  LQ L+   +
Sbjct: 178 LFGCGAVLLRGAGCTVNDLLDRDIDNKVERTKSRPFASGILTPTQGVGFLGLQLLLGLGI 237

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           LLQ N +   +G + L +   YP  KRF   PQ  LG+ F  G  +GW A+  S   PA 
Sbjct: 238 LLQLNNYSRILGASSLLLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAIKESLD-PAI 296

Query: 189 FLCIGT--IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
            L + T  I W + +DT+YAHQDK+DD  +GV STA  F   TK W+
Sbjct: 297 ILPLYTAGICWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDLTKHWI 343


>gi|153835512|ref|ZP_01988179.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio harveyi HY01]
 gi|148867925|gb|EDL67137.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio harveyi HY01]
          Length = 284

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 89/288 (30%), Positives = 144/288 (50%), Gaps = 19/288 (6%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P +W+ V+AA      G+  W+     L ++++G  + R A 
Sbjct: 9   YWQLMRMDRPIGSLLLLWPTVWALVIAA-----QGMPSWNV----LIVFVLGVFLMRSAG 59

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT+ RPLPSG+ T  +A+   ++  + SF+L+L  NP  I + F
Sbjct: 60  CVINDFADRKVDGHVKRTKQRPLPSGKVTSKEAIGLFLVLGISSFLLVLTMNPLTIKLSF 119

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A +F++ +YPF KR+   PQ+ LG+ F+  + + W A      W  +F+ +    W + +
Sbjct: 120 AGIFLAFIYPFMKRYTHLPQLFLGLAFSWAIPMAWAAQTGELPWIVWFVFVINALWTIAY 179

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF-----F 256
           DT YA  D+ DD  IG+ STA LF    KL    + G+  L  +    LL  ++     +
Sbjct: 180 DTQYAMVDRDDDLKIGIKSTAILFGRHDKL----VIGVLQLVTLAMLVLLGQHYELGQSY 235

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            W  +L+A  L + +   +       C   F +   VG++I I L+I+
Sbjct: 236 YWT-ILVAASLFVYQQHLIRHRERDLCFKAFLNNNYVGMVIAIGLLIA 282


>gi|329851194|ref|ZP_08265951.1| 4-hydroxybenzoate polyprenyl transferase [Asticcacaulis
           biprosthecum C19]
 gi|328840040|gb|EGF89612.1| 4-hydroxybenzoate polyprenyl transferase [Asticcacaulis
           biprosthecum C19]
          Length = 308

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 92/297 (30%), Positives = 140/297 (47%), Gaps = 8/297 (2%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
            WV D     A+ P++ L R+    G  L  LP     +  A+  +R  +  W    + L
Sbjct: 15  NWV-DRYAPPALRPWLRLGRFDRPIGIWLLFLP---GAMGLAFATQRPELFPW----YKL 66

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
            ++ +GA + R A C +ND VD DID+QV RTR RP+PSGQ    QAL+F  +  LIS  
Sbjct: 67  LLFAIGAALMRAAGCAYNDFVDRDIDAQVERTRGRPIPSGQIKPKQALLFVAVCSLISLG 126

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           +LLQ     I +GF  L +   YPF KR    PQ  LGI F  G  +   ++       A
Sbjct: 127 ILLQLGTLAILLGFVSLGLVAAYPFMKRITWWPQAWLGITFNWGFPMAVASVAGEVPLAA 186

Query: 188 FFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA 247
           +    G I W + +DT+YA QD +DD  +GV S+AR      K  + + YG+ V+     
Sbjct: 187 WIFYAGLIVWTIGYDTIYALQDIEDDAFVGVKSSARAMGGHAKTGISLFYGLAVVLTATG 246

Query: 248 FCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
                     ++GL         +++ L +  +      F +    G+L +  L+++
Sbjct: 247 AVFHQAGPLFFVGLCAVTGHLALQVLRLRLGDNDLALRLFKANRTTGLLWVASLVLA 303


>gi|167626672|ref|YP_001677172.1| 4-hydroxybenzoate polyprenyltransferase [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|189036988|sp|B0U042|UBIA_FRAP2 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|167596673|gb|ABZ86671.1| 4-hydroxybenzoate octaprenyltransferase [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
          Length = 285

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 86/289 (29%), Positives = 144/289 (49%), Gaps = 9/289 (3%)

Query: 16  GSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAI 75
            +    Y+ L R H      L + P L + VLA++ +             YL ++ +G +
Sbjct: 4   NTKFKAYIMLMRLHRPIPILLILWPTLTALVLASHGIPDIK---------YLIVFTIGVV 54

Query: 76  VTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPF 135
           V R   C  ND+ D D D  V RT +RPL SG+ +   AL   +   +I+F+ +L  N +
Sbjct: 55  VMRTVGCIVNDIADIDFDKYVERTNTRPLTSGKLSVKNALYLCLALTIIAFICVLFLNLY 114

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTI 195
            I + F  LF+++LYPF KRF   PQ++LG+ F  G+F+ + A+       A+   + TI
Sbjct: 115 TILLSFVALFLAVLYPFCKRFFAIPQLILGLAFNFGIFMAFSAIENQIPLEAWIFYLSTI 174

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT+YA  D+  D  IG+ S+A LF  +   ++F+   I ++  +     L+ N 
Sbjct: 175 CWTIAYDTIYALADRDFDLEIGIKSSAVLFGDKVFKYIFLFNFISLILLIALGIYLSFNI 234

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
             +IG++I+ FL I+            C   F     +G++I I ++I 
Sbjct: 235 IFYIGVIISAFLFIRNYFLYKKLGITNCIKAFSDNHWIGLIIFILVVIQ 283


>gi|71082853|ref|YP_265572.1| 4-hydroxybenzoate octaprenyltransferase [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|71061966|gb|AAZ20969.1| 4-hydroxybenzoate octaprenyltransferase [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 287

 Score =  137 bits (344), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 86/286 (30%), Positives = 146/286 (51%), Gaps = 6/286 (2%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G+ L   PC W   LA Y   +      +  F+YL ++ +G+++ R A 
Sbjct: 7   FIELTRLKRPIGYMLLFWPCAWGLTLA-YDFSK----NLNDYFFYLLLFFLGSVLMRSAG 61

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND+ D + D +V RT++RP+ S Q +    + + ++  L++ ++L+ FN   I +  
Sbjct: 62  CVVNDISDKEFDKKVSRTKNRPIASNQVSIKLGIFYTLILCLLALLVLINFNNLTILLAL 121

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + ++  YP  KRF   PQ+ LGI F  G+ +GW A+    +  A     G IFW + +
Sbjct: 122 GSMPLAFTYPLMKRFTYWPQLFLGITFNYGLILGWTAIQGEINAVAIIFYFGAIFWTLGY 181

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT+Y  QD KDDE+IGV ST+  F  + K ++   Y   +   ++   ++  N+F +  L
Sbjct: 182 DTIYGFQDIKDDEIIGVKSTSIKFKNKPKNFVSTCYVFLIFSILIVGYMMNYNYFFYASL 241

Query: 262 LIAL-FLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
           LI +  L   +I + +      C   F S  +VG+LI   ++I  F
Sbjct: 242 LITIAHLFFYQIKSFNPKSPSMCLKVFKSNNLVGLLIFCNILIGKF 287


>gi|159474588|ref|XP_001695407.1| para-hydroxybenzoate-polyprenyltransferase [Chlamydomonas
           reinhardtii]
 gi|158275890|gb|EDP01665.1| para-hydroxybenzoate-polyprenyltransferase [Chlamydomonas
           reinhardtii]
          Length = 285

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 108/211 (51%), Gaps = 8/211 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L  LPC+WS  LA      AG L      + + ++  GA++ RGA
Sbjct: 10  PYAQLMRLDKPIGTWLLALPCIWSIGLAT----PAGQL---PSLYMMALFGAGAVLLRGA 62

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL D  +D+ V RTRSRPL +G      A+   V+Q  +  V+LLQ N +   +G
Sbjct: 63  GCTINDLWDRRLDAAVERTRSRPLAAGTLQPRDAVALLVVQLSLGLVILLQLNDYSKLLG 122

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT-IFWVV 199
            + L +   YP  KR    PQ  LG+    G  +G+ A+     W       G  + W +
Sbjct: 123 ASSLALVGTYPLMKRITFWPQAFLGLTMNWGALLGYSAVAGGVDWAVCLPLYGAGVAWTL 182

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
            +DT+YAHQDKKDD  +GV STA LF   +K
Sbjct: 183 VYDTIYAHQDKKDDARVGVKSTALLFGAASK 213


>gi|298492524|ref|YP_003722701.1| 4-hydroxybenzoate polyprenyl transferase ['Nostoc azollae' 0708]
 gi|298234442|gb|ADI65578.1| 4-hydroxybenzoate polyprenyl transferase ['Nostoc azollae' 0708]
          Length = 293

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 83/245 (33%), Positives = 122/245 (49%), Gaps = 15/245 (6%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAY---PLRRAGVLGWSTIFWYLFIYIVGAIVTRG 79
           + L RWH   G  + ++P LW+  LAA    PL   GV+            I+G + T  
Sbjct: 17  IRLLRWHKPEGRLILMIPALWAIFLAAAGKPPLALVGVI------------ILGTLATSA 64

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICV 139
           A C  NDL D DID QV RTR RPL S   +    +V  ++    + VL    NP    +
Sbjct: 65  AGCVVNDLWDRDIDPQVERTRERPLASRALSLKVGIVVGIVALACALVLAFYLNPLSFWL 124

Query: 140 GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVV 199
             A + + L YP +KR    PQ+VL I +   V + W A+  + S P + L   T+FW +
Sbjct: 125 SVAAVPVILFYPGAKRVFPVPQLVLSIAWGFAVLISWSAVTQNISTPTWLLWGATVFWTL 184

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
            FDT+YA  D++DD+ IGVNS+A  F     + + I +   ++       L+ +N F WI
Sbjct: 185 GFDTIYAMSDRQDDQRIGVNSSALFFGKYAPIAIGIFFAGTIILLAGEGILVNLNGFFWI 244

Query: 260 GLLIA 264
            L+ +
Sbjct: 245 TLITS 249


>gi|91762724|ref|ZP_01264689.1| 4-hydroxybenzoate octaprenyltransferase [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91718526|gb|EAS85176.1| 4-hydroxybenzoate octaprenyltransferase [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 287

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 86/286 (30%), Positives = 146/286 (51%), Gaps = 6/286 (2%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G+ L   PC W   LA Y   +      +  F+YL ++ +G+++ R A 
Sbjct: 7   FIELTRLKRPIGYMLLFWPCAWGLTLA-YDFSK----NLNDYFFYLLLFFLGSVLMRSAG 61

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND+ D + D +V RT++RP+ S Q +    + + ++  L++ ++L+ FN   I +  
Sbjct: 62  CIVNDISDKEFDKKVSRTKNRPIASNQVSIKLGIFYTLILCLLALLVLINFNNLTILLAL 121

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + ++  YP  KRF   PQ+ LGI F  G+ +GW A+    +  A     G IFW + +
Sbjct: 122 GSMPLAFTYPLMKRFTYWPQLFLGITFNYGLILGWTAIQGEINAIAIIFYFGAIFWTLGY 181

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT+Y  QD KDDE+IGV ST+  F  + K ++   Y   +   ++   ++  N+F +  L
Sbjct: 182 DTIYGFQDIKDDEIIGVKSTSIKFKNKPKNFVSTCYVFLIFSILIVGYMMNYNYFFYASL 241

Query: 262 LIAL-FLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
           LI +  L   +I + +      C   F S  +VG+LI   ++I  F
Sbjct: 242 LITIAHLFFYQIKSFNPKIPSMCLKVFKSNNLVGLLIFCNILIGKF 287


>gi|302036274|ref|YP_003796596.1| 4-hydroxybenzoate octaprenyltransferase [Candidatus Nitrospira
           defluvii]
 gi|300604338|emb|CBK40670.1| 4-hydroxybenzoate octaprenyltransferase [Candidatus Nitrospira
           defluvii]
          Length = 281

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 83/242 (34%), Positives = 126/242 (52%), Gaps = 7/242 (2%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
            W L ++ +GA V R      NDL D + D  V RTR+RPL  G+    QAL+ A+   L
Sbjct: 34  MWLLSVFTLGAFVMRSLGVVLNDLADRNFDKHVARTRTRPLADGRLAPRQALLVALGLTL 93

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           I+  L++  NP  + +    L ++ +YPFSKR+I  PQ VLGI F  G  + W A   S 
Sbjct: 94  IATALVITLNPITMLLSPIALLLAAIYPFSKRWIQIPQGVLGIAFGWGAVMAWAASRGSI 153

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
             PA++L   T  W + +DT+YA QD++DD  IGV S+A LF     + + +     V+C
Sbjct: 154 EAPAWWLFAATTCWAIAYDTIYALQDREDDRRIGVKSSALLFGEAVPVAVGLFLVGMVVC 213

Query: 244 FMVAFCL--LTVNFFAWIGLLIALFL-TIKRIIALDISCSKQCC-SFFHSAGVVGILILI 299
            +VA  L  L + ++  + +   +FL  ++R   L    S Q   + F      G+ IL+
Sbjct: 214 LVVAGRLSGLRMGYYLMLAMPTGVFLWQVRR---LQAPVSPQIAFAMFKQHVYSGVAILV 270

Query: 300 CL 301
            +
Sbjct: 271 GI 272


>gi|303280820|ref|XP_003059702.1| UbiA prenyltransferase domain-containing protein [Micromonas
           pusilla CCMP1545]
 gi|226458357|gb|EEH55654.1| UbiA prenyltransferase domain-containing protein [Micromonas
           pusilla CCMP1545]
          Length = 430

 Score =  135 bits (340), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 94/298 (31%), Positives = 139/298 (46%), Gaps = 9/298 (3%)

Query: 6   NFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFW 65
              WV D  +  A+APY  LAR     G +L + PC WS  +AA         G +    
Sbjct: 133 EHTWV-DRALPPALAPYAKLARIDRPVGVYLLMWPCFWSIAVAA-------APGAAPDPT 184

Query: 66  YLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLIS 125
            L ++  G+++ RGA CT ND+ D DID  V RTR+RP+ SG  +   A  F   Q    
Sbjct: 185 LLALFGAGSVLLRGAGCTINDMWDKDIDKLVARTRNRPIASGAVSPAAATAFLGAQLGAG 244

Query: 126 FVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFS- 184
             +LLQ N F   +G + L +   YP  KR    PQ  LG+ F  G  +G+ A+H +   
Sbjct: 245 LAVLLQLNDFSKLLGASSLALVATYPLMKRITNWPQAFLGLTFNWGALLGYAAVHGTLDP 304

Query: 185 WPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCF 244
           +    L +    W + +DT+YAHQDK DD  +GV STA  F   TK +L  L  +     
Sbjct: 305 YVTLPLYLSAASWTLLYDTIYAHQDKDDDARVGVKSTALHFGDDTKKYLAGLGALSTAGL 364

Query: 245 MVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           + +     +    ++G+  A      ++  +D+     C   F S G  G L+   ++
Sbjct: 365 LTSGAAAGLGAPFYLGVSAAAAHLAWQVRDVDLDDRDDCARKFKSNGTYGGLVFAAIV 422


>gi|319778841|ref|YP_004129754.1| 4-hydroxybenzoate polyprenyltransferase [Taylorella equigenitalis
           MCE9]
 gi|317108865|gb|ADU91611.1| 4-hydroxybenzoate polyprenyltransferase [Taylorella equigenitalis
           MCE9]
          Length = 315

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 90/288 (31%), Positives = 147/288 (51%), Gaps = 9/288 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LAR     G   A++    + V AA  L         TI     ++++G ++ R A
Sbjct: 33  PYARLARLDRPAGTWFALITTFMALVQAAGTLPNIK----RTI-----VFMLGTVLLRSA 83

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C  ND+ D D D  V RTR RPL SGQ T  QA++F V+  LI+ +LL   N + I + 
Sbjct: 84  GCAINDIWDRDFDKHVERTRLRPLTSGQLTLRQAIIFFVVLMLIACLLLFFLNTYSILLA 143

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            AL+ + ++YP  KRF   PQ++LGI F  G+ + W        + AF + +G + W + 
Sbjct: 144 LALVPLVIIYPLGKRFTFWPQIILGITFNWGMLMAWSDTINEIPFGAFLMYLGVVSWHLA 203

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT YA+ D + D  +G+ STAR F  + K W+   Y + VLC+++A  LL +++  ++ 
Sbjct: 204 YDTFYAYCDVEFDTKLGLKSTARYFGSEGKKWISGFYIVSVLCWLIAGYLLYMSWGYFVF 263

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLD 308
           L +  F    ++   ++         F     V +L+L+ + + +  D
Sbjct: 264 LTVVAFALYGQLKRFEVDNPAGNFQLFKDNLFVNVLLLVAICLGVMFD 311


>gi|17553718|ref|NP_498513.1| COenzyme Q (ubiquinone) biosynthesis family member (coq-2)
           [Caenorhabditis elegans]
 gi|90111985|sp|Q8I7J4|COQ2_CAEEL RecName: Full=4-hydroxybenzoate polyprenyltransferase,
           mitochondrial; AltName:
           Full=Para-hydroxybenzoate--polyprenyltransferase;
           Short=PHB:polyprenyltransferase; Flags: Precursor
 gi|59676920|gb|AAW88395.1| Coenzyme q (ubiquinone) biosynthesis protein 2, isoform a,
           confirmed by transcript evidence [Caenorhabditis
           elegans]
          Length = 356

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 141/293 (48%), Gaps = 10/293 (3%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L   PC WS  +A      AG L      + L ++  GA + R
Sbjct: 62  LKPYLQLMRVDKPIGTWLLYWPCTWSIAMAT----PAGQL---PSIYMLSLFGAGAFLMR 114

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
            A C  NDL D D D +V RT+ RPL  G  T  QA+         S  +LLQ N + + 
Sbjct: 115 SAGCVINDLWDKDFDKKVERTKLRPLACGSLTEKQAIGLLAGLLSSSLAILLQLNWYSVA 174

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTIFW 197
           VG + + + + YP +KRF   PQ VLG+ F  G  +GW AL    S  A F++    + W
Sbjct: 175 VGASSMALVVGYPLAKRFTYWPQFVLGLTFNWGALLGWCALKGDLSSSAPFWMYAAALQW 234

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFA 257
            + +DT+YAHQDK DD +IGV STA      TK WL   +G+  +  + A  + +   + 
Sbjct: 235 TLIYDTIYAHQDKADDIMIGVKSTALRLGADTKKWLSA-FGVGTVASLTACGIASDQTWP 293

Query: 258 WIGLLIALFLTIK-RIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQ 309
           +   L A    +  ++  +DI     C   F S   +GI++   ++ S  L +
Sbjct: 294 YYVALAATTAQLGWQVGTVDIDNGSDCWDKFKSNSWMGIILFSGIVASTLLKE 346


>gi|269468167|gb|EEZ79866.1| 4-hydroxybenzoate polyprenyltransferase [uncultured SUP05 cluster
           bacterium]
          Length = 280

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 90/283 (31%), Positives = 147/283 (51%), Gaps = 9/283 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L R     G +L + P LW+  LAA         GW +I   L I+I+G  + R A 
Sbjct: 4   YLRLMRLDKPIGIYLLLWPTLWALFLAAD--------GWPSI-ELLIIFILGVALMRSAG 54

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D +ID  + RT++RP+ SG+ T   AL   +    ++F+L+L  N   + + F
Sbjct: 55  CVINDYADRNIDKLIERTKNRPITSGEVTTGNALKLFIGLVGLAFLLVLLTNWLTVQLAF 114

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             LF+++LYPF+KR+   PQ VLG+ FA  V + + A + +    A+++ + TI W V +
Sbjct: 115 VALFLAMLYPFTKRWTHLPQFVLGLAFAMSVPMAFAATNNNVPVSAWWIFLATIIWTVIY 174

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT+YA  D+++D  IGV STA LF+   K  + +L    +L  +    +  +  F  I L
Sbjct: 175 DTMYAMSDREEDLKIGVKSTAILFAKYDKWIIGVLQISLLLTLIKISEIFNLAVFYDISL 234

Query: 262 LIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           +++ FL I   + +       C   F     +G++I   + +S
Sbjct: 235 ILSAFLMIYHQVLIKNREKTACFQAFLHNNYLGMVIFAGIALS 277


>gi|294010079|ref|YP_003543539.1| 4-hydroxybenzoate octaprenyltransferase [Sphingobium japonicum
           UT26S]
 gi|292673409|dbj|BAI94927.1| 4-hydroxybenzoate octaprenyltransferase [Sphingobium japonicum
           UT26S]
          Length = 300

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 105/198 (53%), Gaps = 9/198 (4%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           LAR+    GW L   P  W+  LA    +R     W  I W L     G+I  RGA C +
Sbjct: 28  LARFDRPIGWWLLFWPGAWAVALAGGAGQR-----WPLILWLLL----GSIAMRGAGCVF 78

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND+VD  +D QV RT SRPL SG  +   A ++ +   L+   +LLQ +P+   V    L
Sbjct: 79  NDIVDRGLDRQVARTASRPLASGAVSLRTAWIWLLSLCLVGLAVLLQLHPYAQVVALGSL 138

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            +   YPF KR    PQ+ LG+ F+    VGW  +  + + P   L  G I WVV +DT+
Sbjct: 139 ALVAAYPFMKRITGWPQIWLGLVFSWAALVGWSEVAGTLAMPGLLLYGGCIVWVVGYDTI 198

Query: 205 YAHQDKKDDELIGVNSTA 222
           YA QD++DD LIG+ S+A
Sbjct: 199 YALQDREDDALIGIGSSA 216


>gi|103487752|ref|YP_617313.1| 4-hydroxybenzoate polyprenyltransferase [Sphingopyxis alaskensis
           RB2256]
 gi|98977829|gb|ABF53980.1| 4-hydroxybenzoate octaprenyltransferase [Sphingopyxis alaskensis
           RB2256]
          Length = 302

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 93/287 (32%), Positives = 140/287 (48%), Gaps = 9/287 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           +A  PY  LAR+    GW L   PC +   L         V  W  + W+L     GAI 
Sbjct: 20  AAARPYALLARFDRPIGWWLLYWPCAFGVALGG-----GAVSHWPLLLWFLL----GAIA 70

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA C +ND+VD D D++V RT SRP+ SG  +   AL++AVL  L+  ++L+Q     
Sbjct: 71  MRGAGCVYNDIVDRDFDAKVARTASRPVASGAVSVRNALLWAVLLSLVGLLVLVQLPRPA 130

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
             V  A L +   YPF KR    PQ  LG+ F+ G  V W A+          L  G I 
Sbjct: 131 QIVALASLILVAAYPFMKRITWWPQAWLGLVFSWGALVAWVAVGGVQGMALPLLYAGCIA 190

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
           WV+ +DT+YA QD +DD L+GV S+AR    Q K  + + Y   +  +  A   +  +  
Sbjct: 191 WVIGYDTIYALQDIEDDMLVGVKSSARAMGGQVKAGVALCYAAALGLWGGALWTVRPDPL 250

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLII 303
             + L+ A      +++ LD++  +   + F S    G+L+   +++
Sbjct: 251 VLVALIPAALQLTGQVVTLDVAKGEDALAKFRSNRFAGLLVFAAMLV 297


>gi|328782186|ref|XP_001120171.2| PREDICTED: LOW QUALITY PROTEIN: 4-hydroxybenzoate
           polyprenyltransferase, mitochondrial, partial [Apis
           mellifera]
          Length = 300

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 138/261 (52%), Gaps = 12/261 (4%)

Query: 40  PCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRT 99
           PC WS  +AA P       G    F  L ++ +GA + RGA C  ND+ D DID  V RT
Sbjct: 16  PCGWSIAMAAAP-------GALPDFQLLSLFGIGAFIMRGAGCIINDMWDQDIDGMVART 68

Query: 100 RSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILC 159
           + RPL + + +  Q+L+F   Q  +  ++LLQ N + I +G + L + ++YP  KR    
Sbjct: 69  KDRPLVTREISPLQSLIFLGSQLTLGLLILLQLNLYSIILGASSLVLVIIYPVMKRITYW 128

Query: 160 PQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTIFWVVYFDTVYAHQDKKDDELIGV 218
           PQ++LG+ F  G  +GW A+  S +W     L    I W + +DT+YAHQDK DD +IG+
Sbjct: 129 PQLILGMTFNWGALLGWSAVEGSCNWSVCLPLYTAGICWTLLYDTIYAHQDKMDDVIIGI 188

Query: 219 NSTARLFSYQTKLWLFILYGIFVLCFMVAFCLL--TVNFFAWIGLLIALFLTIKRIIALD 276
            STA  F  ++K++L     + +   + +  L   T  ++  +GL+      + +I  L+
Sbjct: 189 KSTALKFGDKSKIYLSGFSTVMITGLIASGILAAQTWPYYTAVGLVGTHL--VNQIYNLN 246

Query: 277 ISCSKQCCSFFHSAGVVGILI 297
           I+    C   F S   +G++I
Sbjct: 247 INPPADCAKKFISNHRIGMII 267


>gi|253997770|ref|YP_003049833.1| 4-hydroxybenzoate polyprenyl transferase [Methylovorus sp. SIP3-4]
 gi|253984449|gb|ACT49306.1| 4-hydroxybenzoate polyprenyl transferase [Methylovorus sp. SIP3-4]
          Length = 291

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 138/269 (51%), Gaps = 10/269 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  LA+       VL          ++++G ++ R A 
Sbjct: 11  YWRLTRMDKPIGILLLLWPTLWALWLASAGKPDLKVLA---------VFVLGTVLMRAAG 61

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND+ D + D  V RTR RPL +G+ +  +AL+ A++  LI+F L++Q N   + + F
Sbjct: 62  CVMNDMADRNFDGHVARTRHRPLATGEVSVKEALLLAMILSLIAFALVMQLNKLTVLLSF 121

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             LF++  YP +KR I  PQ  LG+ F  G+ + + A   S    A+FL +G +FW + +
Sbjct: 122 PALFLAASYPLTKRVIAIPQAYLGVAFGFGIPMAYAAQTGSIPGIAWFLLLGNVFWAIAY 181

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IG+ S+A  F  +    + + YG+ +   ++      +++  ++GL
Sbjct: 182 DTEYAMVDRADDLKIGIRSSAIFFGPRDVAAIMLSYGVLLGVLLLTGLHYGLDWPYYLGL 241

Query: 262 LIALFLTIKRIIALDISCSKQC-CSFFHS 289
           +IA  L +   + +      +C  +F H+
Sbjct: 242 IIAAMLAVYHYLLIRERQPARCFKAFLHN 270


>gi|302794210|ref|XP_002978869.1| hypothetical protein SELMODRAFT_24149 [Selaginella moellendorffii]
 gi|300153187|gb|EFJ19826.1| hypothetical protein SELMODRAFT_24149 [Selaginella moellendorffii]
          Length = 294

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 143/289 (49%), Gaps = 10/289 (3%)

Query: 18  AIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVT 77
           ++ P+  LAR     G  L   PC WS  LAA     AG L        L ++  GAI+ 
Sbjct: 12  SLQPFACLARLDKPIGTWLLAWPCFWSIALAA----PAGSL---PDLKMLALFGTGAILL 64

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           RGA CT NDL+D DID +V RT+ RP+ SG  +  Q + F   Q L+   +LLQ N F  
Sbjct: 65  RGAGCTVNDLLDRDIDGKVDRTKLRPIASGALSPAQGVGFLGCQLLLGLGILLQLNDFSR 124

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLC--IGTI 195
            +G + L +   YP  KR+   PQ  LG+ F  G  +GW A+  S + PA  L   +  I
Sbjct: 125 ILGASSLLLVGTYPLMKRWTFWPQAYLGLTFNWGALLGWSAIQGSLN-PAVVLPLYLSGI 183

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT+YAHQDK+DD  +GV STA  F   T LWL       V    +A     + +
Sbjct: 184 CWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDHTCLWLTGFSAASVSFLALAGYNTGIGW 243

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
             + G+L        ++  LDIS S  C   F S   +G ++   +++ 
Sbjct: 244 PFYGGVLGTACHLAWQLQTLDISNSDDCNRKFGSNKWLGAIVFGGIVLG 292


>gi|254447707|ref|ZP_05061173.1| 4-hydroxybenzoate polyprenyl transferase [gamma proteobacterium
           HTCC5015]
 gi|198263050|gb|EDY87329.1| 4-hydroxybenzoate polyprenyl transferase [gamma proteobacterium
           HTCC5015]
          Length = 304

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 128/244 (52%), Gaps = 12/244 (4%)

Query: 1   MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGW 60
           ++Q+FN    R  +   A+  Y YL R H   G +L + P LW+  +AA      G+  W
Sbjct: 7   LNQWFNATPQRQRLADRALQ-YSYLTRLHRRIGIYLVMWPTLWALWIAA-----EGIPPW 60

Query: 61  STIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQAL-VFAV 119
                 L I++ G ++ R A C  ND  D D D  V RT  RPL +G+ +  +AL VFA 
Sbjct: 61  DI----LCIFVAGCVLMRSAGCAINDYADRDFDPHVWRTEDRPLANGKVSPKEALAVFAT 116

Query: 120 LQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL 179
           L   I+FVL+L  NP  I + FA   ++  YPF+KR    PQVVLG  F+  + +G+ A+
Sbjct: 117 LCG-IAFVLVLFTNPLTIYLSFAAAALAAAYPFAKRHTYLPQVVLGAAFSMAIPMGFAAV 175

Query: 180 HASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGI 239
                  A+ L    + W V +DT+YA  D++DD  IGV STA LF     L    L G+
Sbjct: 176 LNEVPVMAWLLFTANVVWTVAYDTMYAMADREDDLKIGVKSTAILFGEADVLITMSLCGL 235

Query: 240 FVLC 243
           F+L 
Sbjct: 236 FLLA 239


>gi|296417216|ref|XP_002838255.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634181|emb|CAZ82446.1| unnamed protein product [Tuber melanosporum]
          Length = 411

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 128/276 (46%), Gaps = 13/276 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R    TG     LPCLWST+LA        V    T+    F++  GA++ RGA
Sbjct: 90  PYAELIRLDKPTGTIYLFLPCLWSTLLAG--TLTDPVTPLPTVLGTTFLFATGALIMRGA 147

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL+D +ID  V RT+ RP+  G  T F AL F  +Q L    +L+QF    I  G
Sbjct: 148 GCTINDLLDRNIDLHVSRTKFRPIARGAITPFNALAFTCVQLLAGLAVLVQFPAQTIIWG 207

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP--AFFLCI--GTIF 196
              L +  +YP  KR    PQ VLG+ F+ G  +G+ AL      P  A   C+    + 
Sbjct: 208 IPSLAVVTVYPLMKRATHYPQFVLGLAFSWGALLGFPALGLGLDGPVMATAACLYGSNVA 267

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFIL----YGIFVLCFMVAFCLLT 252
           W V +D VYAHQD +DD   GV S        TK  +  L     G+      VA C   
Sbjct: 268 WTVVYDIVYAHQDVRDDVKAGVKSIVVKHEAYTKYLMSALGAAQVGLLASAGAVAGCGPV 327

Query: 253 VNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFH 288
               +  G   +L   I+++   D+   K+C  +F 
Sbjct: 328 FYLVSCGGAAGSLAYMIRKVNLKDV---KECWYYFE 360


>gi|254570801|ref|XP_002492510.1| Para hydroxybenzoate: polyprenyl transferase [Pichia pastoris
           GS115]
 gi|238032308|emb|CAY70331.1| Para hydroxybenzoate: polyprenyl transferase [Pichia pastoris
           GS115]
 gi|328353480|emb|CCA39878.1| 4-hydroxybenzoate hexaprenyltransferase [Pichia pastoris CBS 7435]
          Length = 365

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 87/270 (32%), Positives = 135/270 (50%), Gaps = 6/270 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L   PC WS  +AAY    +     S+  W L ++ VGA++ RGA
Sbjct: 77  PYAELMRLEKPIGSWLLYSPCTWSITMAAY----STTAPLSSTLWMLGVFGVGALIMRGA 132

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL+D D+D++V RT  RPL S + T  QA+ F   Q  +   +LLQ       +G
Sbjct: 133 GCTINDLLDRDLDNKVERTIERPLASRRVTPKQAITFLGAQLAVGLGVLLQLPADCFLLG 192

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTIFWVV 199
              L    +YP  KR    PQVVL   F  G  +G+ A+   ++W +   L + +  W +
Sbjct: 193 AVSLVPVAVYPLFKRITYYPQVVLSSCFTWGALLGFPAM-GVWNWSSMIPLYLSSFAWCM 251

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
            +DT+YAHQDKK D   G+ STA  +  ++K  ++ L  I +  F ++  + ++     +
Sbjct: 252 TYDTIYAHQDKKFDVKAGIKSTALAWGDKSKPIMYGLTTIQMATFALSGYMNSMGPGFAL 311

Query: 260 GLLIALFLTIKRIIALDISCSKQCCSFFHS 289
           G +I  +   + +  +D+   K C   F +
Sbjct: 312 GAIIGGYRVFQMVRKVDLDNPKDCWYHFRN 341


>gi|148284149|ref|YP_001248239.1| prenyltransferase [Orientia tsutsugamushi str. Boryong]
 gi|146739588|emb|CAM79340.1| 4-hydroxybenzoate octaprenyltransferase [Orientia tsutsugamushi
           str. Boryong]
          Length = 292

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 87/285 (30%), Positives = 149/285 (52%), Gaps = 13/285 (4%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           + L+R ++  G  L   PC +   L +    +         +  L I  +G+I+ R   C
Sbjct: 15  IKLSRLNNPVGIFLLFFPCCFGIGLVSLEQVK---------YNSLVILFLGSILMRSFGC 65

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFA 142
             ND+VD DID +V RT+ RPL + Q T   A+++ ++  +++ +LL+Q +   I +   
Sbjct: 66  IVNDIVDKDIDCRVARTKLRPLANNQITVTNAIIYLMVISMVALMLLMQLSNLAIFLAIL 125

Query: 143 LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFD 202
              +  +YPF KR    PQVVLGI F  G  + +  +  + +  +  + IG IFW + +D
Sbjct: 126 ASTLIFIYPFMKRITYYPQVVLGIIFNSGALISYANVTNNLTIASVVMYIGCIFWTIGYD 185

Query: 203 TVYAHQDKKDDELIGVNSTAR-LFSYQTKLWLFI-LYGIFVLCFMVAFCL--LTVNFFAW 258
           T+YA  D  DDE I V S A  L + + KLW+   LY  F+  F+ +  L    ++ FA 
Sbjct: 186 TIYAFADAADDEKIKVKSLALVLKNNKYKLWILASLYLTFISMFVESILLSAFKLSIFAV 245

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLII 303
           + ++ A  L + +I+ LD++    C + F +  +VG+L+ I +I+
Sbjct: 246 LFIVAATALLMWQIVTLDVTQPLNCLTRFKANTIVGLLLFIAMIL 290


>gi|33594820|ref|NP_882463.1| 4-hydroxybenzoate octaprenyltransferase [Bordetella parapertussis
           12822]
 gi|33564896|emb|CAE39841.1| UbiA prenyltransferase family protein [Bordetella parapertussis]
          Length = 308

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 113/220 (51%), Gaps = 15/220 (6%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAA---YPLRRAGVLGWSTIFWYLFIYIVGAIVT 77
           PY  L R     G  L +LPC+ + V AA     LRR            L I+ +GA++ 
Sbjct: 30  PYARLCRLDRPIGTWLTLLPCIAALVQAAGGLPDLRR------------LLIFSLGALLM 77

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           RG  CT ND+ D DID  V RTR RPL SGQ +  QA+ F + Q L+   LL   N    
Sbjct: 78  RGIGCTVNDMWDRDIDKHVERTRFRPLTSGQLSMRQAVAFLIGQLLVCASLLFFINDMSR 137

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFW 197
            +  A+L    +YPF KR    PQVVLGI F  G+ + W          A  + +G + W
Sbjct: 138 WLAVAVLPFVFIYPFCKRVTYWPQVVLGICFNWGMLMAWSDTQDHLPLAAIAMWLGAVLW 197

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY 237
            V +D++YA+ D +DD  +G++STA  F  Q KLW+   Y
Sbjct: 198 QVGYDSIYAYVDVRDDRSLGLHSTATRFGEQGKLWIGGFY 237


>gi|33599092|ref|NP_886652.1| 4-hydroxybenzoate octaprenyltransferase [Bordetella bronchiseptica
           RB50]
 gi|33575138|emb|CAE30601.1| UbiA prenyltransferase family protein [Bordetella bronchiseptica
           RB50]
          Length = 308

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 113/220 (51%), Gaps = 15/220 (6%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAA---YPLRRAGVLGWSTIFWYLFIYIVGAIVT 77
           PY  L R     G  L +LPC+ + V AA     LRR            L I+ +GA++ 
Sbjct: 30  PYARLCRLDRPIGTWLTLLPCIAALVQAAGGLPDLRR------------LLIFSLGALLM 77

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           RG  CT ND+ D DID  V RTR RPL SGQ +  QA+ F + Q L+   LL   N    
Sbjct: 78  RGIGCTVNDMWDRDIDKHVERTRFRPLTSGQLSMRQAVAFLIGQLLVCASLLFFINDMSR 137

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFW 197
            +  A+L    +YPF KR    PQVVLGI F  G+ + W          A  + +G + W
Sbjct: 138 WLAVAVLPFVFIYPFCKRVTYWPQVVLGICFNWGMLMAWSDTQDHLPLAAIAMWLGAVLW 197

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY 237
            V +D++YA+ D +DD  +G++STA  F  Q KLW+   Y
Sbjct: 198 QVGYDSIYAYVDVRDDRSLGLHSTAMRFGEQGKLWIGGFY 237


>gi|330432286|gb|AEC17345.1| 4-hydroxybenzoate octaprenyltransferase [Gallibacterium anatis
           UMN179]
          Length = 286

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 92/287 (32%), Positives = 142/287 (49%), Gaps = 13/287 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L R     G  L + P LW+  LA+  +    +L         FI+I+G +  R A 
Sbjct: 10  YIQLMRLDKPIGSFLLLWPTLWALFLASNGMPDVKIL---------FIFILGVVFMRSAG 60

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  ID +V RT  RPL +G  +  +A +  VL  L+SF L+LQ N + I +  
Sbjct: 61  CVINDYADRHIDGKVKRTSQRPLATGAVSEKEAKILFVLLILLSFFLVLQLNLYAIVLSV 120

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A   ++ +YPF KR+   PQ+ LG  F   + + +GA  AS     + L +  + W + +
Sbjct: 121 AAAVLAFIYPFMKRYTHLPQLFLGAAFGWSIPMAYGATAASLPLSCWLLFLANLAWTIAY 180

Query: 202 DTVYAHQDKKDDELIGVNSTARLFS-YQTK-LWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
           DT YA  D+ DD  IGV STA LF+ Y  K + L  +  + +L ++     L+  +F  I
Sbjct: 181 DTQYAMVDRDDDLRIGVKSTAILFAEYDNKIIALLQIATLAILVYLGVEQQLSNGYF--I 238

Query: 260 GLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
           GLL AL   I +         ++C   F +   VG+ I I +++ + 
Sbjct: 239 GLLPALACFIYQCRLTKRRTREECFKAFLNNNYVGMWIFIAILVGIL 285


>gi|313199834|ref|YP_004038492.1| 4-hydroxybenzoate polyprenyl transferase [Methylovorus sp. MP688]
 gi|312439150|gb|ADQ83256.1| 4-hydroxybenzoate polyprenyl transferase [Methylovorus sp. MP688]
          Length = 275

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 124/224 (55%), Gaps = 1/224 (0%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L ++++G ++ R A C  ND+ D + D  V RTR RPL +G+ +  +AL+ A++  LI+F
Sbjct: 31  LAVFVLGTVLMRAAGCVMNDMADRNFDGHVARTRHRPLATGEVSVKEALLLAMILSLIAF 90

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
            L++Q N   + + F  LF++  YP +KR I  PQ  LG+ F  G+ + + A   S    
Sbjct: 91  ALVMQLNKLTVLLSFPALFLAASYPLTKRVIAIPQAYLGVAFGFGIPMAYAAQTGSIPGI 150

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV 246
           A+FL +G +FW + +DT YA  D+ DD  IG+ S+A  F  +    + + YG+ +   ++
Sbjct: 151 AWFLLLGNVFWAIAYDTEYAMVDRADDLKIGIRSSAIFFGPRDVAAIMLSYGVLLGVLLL 210

Query: 247 AFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQC-CSFFHS 289
                 +++  ++GL+IA  L +   + +      +C  +F H+
Sbjct: 211 TGLHYGLDWPYYLGLIIAAMLAVYHYLLIRERQPARCFKAFLHN 254


>gi|91774410|ref|YP_544166.1| 4-hydroxybenzoate octaprenyltransferase [Methylobacillus
           flagellatus KT]
 gi|118574207|sp|Q1GXB3|UBIA_METFK RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|91708397|gb|ABE48325.1| 4-hydroxybenzoate octaprenyltransferase [Methylobacillus
           flagellatus KT]
          Length = 296

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 88/282 (31%), Positives = 139/282 (49%), Gaps = 12/282 (4%)

Query: 10  VRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFI 69
           +++  +   +  Y  L R     G  L + P LW   LA+         GW      LF+
Sbjct: 1   MKNPSLRQKLEAYYRLTRLDKPIGILLLLWPTLWGIWLASP--------GWPDGL-VLFV 51

Query: 70  YIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLL 129
           +I G ++ R A C  NDL D + D  V RTR RPL +G  T  +A++ A+   L++F+L+
Sbjct: 52  FIAGTVLMRSAGCVMNDLADRNFDGHVERTRQRPLVTGDVTTKEAVLLALALSLVAFILV 111

Query: 130 LQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF 189
           LQ NP V+ + F  LF++  YP +KRF+  PQ  LGI F  G+ + + A+       A+ 
Sbjct: 112 LQLNPLVVALSFPALFLAASYPLTKRFLSIPQAYLGIAFGFGIPMAFAAITGQLPLEAWI 171

Query: 190 LCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFC 249
           L +  +FW + +DT YA  D+ DD  IG+ S+A  F       +   YG F++       
Sbjct: 172 LLLANVFWAIAYDTEYAMVDRNDDLNIGIRSSAIFFGRLDVFAVMACYGAFLILMAWVGV 231

Query: 250 LLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCC--SFFHS 289
            L  ++  + GL +A  + +    AL     +Q C  +F H+
Sbjct: 232 RLQQSWPYFAGLGVAALVALYH-YALIRDRDRQSCFKAFLHN 272


>gi|168030764|ref|XP_001767892.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162680734|gb|EDQ67167.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 244

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 125/241 (51%), Gaps = 9/241 (3%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L ++ VGAI+ RGA CT NDL+D DID +V RTR RP+ SG  T FQ L F  +Q L+  
Sbjct: 2   LSLFGVGAILLRGAGCTVNDLLDRDIDGKVERTRLRPIVSGALTPFQGLTFLGVQLLLGL 61

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGW----GALHAS 182
            +LLQ N F   +G + L +   YP  KR+   PQ  LG+ F  G  +GW    G+L AS
Sbjct: 62  GILLQLNTFSQVLGASSLLLVGTYPLMKRWTFWPQAYLGLTFNWGALLGWAAVRGSLDAS 121

Query: 183 FSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVL 242
            + P +   +G   W + +DT+YAHQDK DD  +GV STA  F   T+LWL       + 
Sbjct: 122 VALPLYLSGVG---WTLVYDTIYAHQDKMDDTKVGVKSTALRFGEDTRLWLTGFSTASIS 178

Query: 243 CFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILIL--IC 300
              +A     + +  ++G+         +I  +D      C   F S   +G L+   IC
Sbjct: 179 GMSLAGYNAALGWPFYVGVAATAGHLAWQISTVDTQSRADCNDKFVSNKWLGALVFSGIC 238

Query: 301 L 301
           L
Sbjct: 239 L 239


>gi|258542800|ref|YP_003188233.1| 4-hydroxybenzoate polyprenyltransferase [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256633878|dbj|BAH99853.1| 4-hydroxybenzoate polyprenyltransferase [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256636937|dbj|BAI02906.1| 4-hydroxybenzoate polyprenyltransferase [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256639990|dbj|BAI05952.1| 4-hydroxybenzoate polyprenyltransferase [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256643046|dbj|BAI09001.1| 4-hydroxybenzoate polyprenyltransferase [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256646101|dbj|BAI12049.1| 4-hydroxybenzoate polyprenyltransferase [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256649154|dbj|BAI15095.1| 4-hydroxybenzoate polyprenyltransferase [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256652141|dbj|BAI18075.1| 4-hydroxybenzoate polyprenyltransferase [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256655198|dbj|BAI21125.1| 4-hydroxybenzoate polyprenyltransferase [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 305

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 92/289 (31%), Positives = 140/289 (48%), Gaps = 7/289 (2%)

Query: 18  AIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVT 77
           A+  Y  LAR     G  L  LP +W  +L        GV   S     + ++ +G++V 
Sbjct: 22  ALQAYALLARLDRPIGTWLLWLPGMWGILLPQ------GV-ATSERIRLIVLFGIGSLVM 74

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           R A C  ND+ D DID QV RT  RPL SG  +  QA +F +L  L    +L+Q N    
Sbjct: 75  RAAGCVVNDMWDRDIDRQVARTAGRPLASGALSMKQATLFLLLLLLAGLAVLVQLNSLSW 134

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFW 197
            +G + L +  LYP +KRF   PQ+V+G  F  G  +G+ A     SW    L   TI W
Sbjct: 135 VLGVSSLLLVALYPLAKRFTWWPQLVMGFTFGFGAPMGYAAAAGHLSWAQAALYAATIVW 194

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFA 257
            + FDT+Y  QD +DD  IGV ST+RL   + + ++   YG+ ++   VA  +       
Sbjct: 195 QLGFDTIYGFQDMEDDARIGVKSTSRLMVGRARGFIGTCYGLMLVLLAVAAVMAGSGPLF 254

Query: 258 WIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
           W+ L++   L  ++   +D      C + F +   +G+ + + L+  L 
Sbjct: 255 WVVLVLPAILLWQQARKVDPISPALCLAQFRANREIGLAVALALVAGLI 303


>gi|302813589|ref|XP_002988480.1| hypothetical protein SELMODRAFT_24144 [Selaginella moellendorffii]
 gi|300143882|gb|EFJ10570.1| hypothetical protein SELMODRAFT_24144 [Selaginella moellendorffii]
          Length = 294

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 106/301 (35%), Positives = 144/301 (47%), Gaps = 34/301 (11%)

Query: 18  AIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVT 77
           ++ P+  LAR     G  L   PC WS  LAA     AG L        L ++  GAI+ 
Sbjct: 12  SLQPFACLARLDKPIGTWLLAWPCFWSIALAA----PAGSL---PDLKMLALFGTGAILL 64

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           RGA CT NDL+D DID +V RT+ RP+ SG  +  Q + F   Q L+   +LLQ N F  
Sbjct: 65  RGAGCTVNDLLDRDIDGKVDRTKLRPIASGALSPAQGVGFLGCQLLLGLGILLQLNDFSR 124

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLC--IGTI 195
            +G + L +   YP  KR+   PQ  LG+ F  G  +GW A+  S + PA  L   +  I
Sbjct: 125 ILGASSLLLVGTYPLMKRWTFWPQAFLGLTFNWGALLGWSAIQGSLN-PAVVLPLYLSGI 183

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL---------FILYGIFVLCFMV 246
            W + +DT+YAHQDK+DD  +GV STA  F   T LWL         F+    +      
Sbjct: 184 CWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDHTCLWLTGFSAASVSFLALAGYNTGIGW 243

Query: 247 AFC---LLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLII 303
            FC   L T   FAW            ++  LDIS S  C   F S   +G ++   +++
Sbjct: 244 PFCGGVLGTACHFAW------------QLQTLDISNSDDCNRKFGSNKWLGAIVFGGIVL 291

Query: 304 S 304
            
Sbjct: 292 G 292


>gi|282898799|ref|ZP_06306786.1| 4-hydroxybenzoate polyprenyl transferase [Cylindrospermopsis
           raciborskii CS-505]
 gi|281196326|gb|EFA71236.1| 4-hydroxybenzoate polyprenyl transferase [Cylindrospermopsis
           raciborskii CS-505]
          Length = 293

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 92/285 (32%), Positives = 141/285 (49%), Gaps = 13/285 (4%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           + L RWH   G  + ++P LW+  LAA                 + + I+G++ T  A C
Sbjct: 17  MRLLRWHKPGGRLILMIPALWALFLAADG---------KPPIILVIVIILGSLATSAAGC 67

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFA 142
             NDL D DID+QV RTR RPL S   +    +V  ++  + + +L    NP    +  +
Sbjct: 68  VVNDLWDRDIDTQVNRTRDRPLASRDLSVKVGVVVGIVALVCAAILAFYLNPLSFWLSVS 127

Query: 143 LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFD 202
            L + LLYP +KR    PQ++L + +   V + W A+  + S P +FL   T+ W + FD
Sbjct: 128 ALPVILLYPGAKRVFPIPQLILSLAWGFAVLISWSAVTGNISLPTWFLWGATVLWTLGFD 187

Query: 203 TVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLL 262
           T+YA  D+ DDE IGV S+A  F  QT   + I +   ++  M     L +N F WI LL
Sbjct: 188 TIYAMSDRLDDERIGVKSSALFFGDQTPNAVGIFFLGTIILLMAEAISLKLNIFFWISLL 247

Query: 263 IAL---FLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           IA    F  + R+    +   +    F  + G +G LIL+ +I+ 
Sbjct: 248 IASLGWFWQVLRLRDPKLPNREYGKMFSQNVG-IGFLILLGMILG 291


>gi|85710793|ref|ZP_01041854.1| 4-hydroxybenzoate polyprenyltransferase [Idiomarina baltica OS145]
 gi|85695197|gb|EAQ33134.1| 4-hydroxybenzoate polyprenyltransferase [Idiomarina baltica OS145]
          Length = 283

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 90/288 (31%), Positives = 147/288 (51%), Gaps = 15/288 (5%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAY---PLRRAGVLGWSTIFWYLFIYIVG 73
           + +  Y  L R     G +L   P LW+ ++A     PL+             + I+++G
Sbjct: 2   NKLNSYWRLMRADRPIGTYLLAWPTLWALLIAGDGNPPLK------------IVVIFMLG 49

Query: 74  AIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFN 133
             + R A C  ND  D ++D  V RT+ RPL +G+    +A++      +++F+L+LQFN
Sbjct: 50  TFLMRSAGCVINDFADRNLDGHVERTKLRPLAAGEVNSTEAILLFFGLLILAFLLVLQFN 109

Query: 134 PFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIG 193
              I + FA   ++ LYPF KR+   PQVVLGI F+ G+ + + AL++   W A  L I 
Sbjct: 110 TQTIMLAFAAAGVASLYPFCKRWTQLPQVVLGIAFSFGILMAFSALNSDQWWLAGGLFIA 169

Query: 194 TIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTV 253
            I W + +DT YA  D+ DD  +G+ STA LF    +L + +L  + ++   V +  L V
Sbjct: 170 NIVWTIAYDTEYAMADRADDLKVGIKSTAILFGRYDRLIIAVLQVVTLIILAVVWHHLNV 229

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICL 301
            ++AW+GL+ A  L   +   +     K C   F     +G++I + L
Sbjct: 230 QWYAWLGLIAAACLFSYQHWMIRERAPKACFQAFLHNHYIGMVIGVSL 277


>gi|282896772|ref|ZP_06304778.1| 4-hydroxybenzoate polyprenyl transferase [Raphidiopsis brookii D9]
 gi|281198181|gb|EFA73071.1| 4-hydroxybenzoate polyprenyl transferase [Raphidiopsis brookii D9]
          Length = 328

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 140/281 (49%), Gaps = 11/281 (3%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           L RWH   G  + ++P LW+  LAA   +   VL        + +  +G++ T  A C  
Sbjct: 54  LLRWHKPEGRLILMIPALWALFLAADG-KPPTVL--------VVVITLGSLATSAAGCVV 104

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           NDL D DID+QV RTR RPL S   +    +V  ++  + + +L    NP    +  + +
Sbjct: 105 NDLWDRDIDTQVNRTRDRPLASRDLSVKVGVVVGMVALVCAAILAFYLNPLSFWLSVSAV 164

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            + LLYP +KR    PQ++L + +   V + W A+  + S P +FL   T+ W + FDT+
Sbjct: 165 PVILLYPGAKRVFPIPQLILSLAWGFAVLISWSAVTGNISLPTWFLWGATVLWTLGFDTI 224

Query: 205 YAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIA 264
           YA  D+ DD+ IGV S+A  F  QT   + I +   ++  M     L +N F WI LLIA
Sbjct: 225 YAMSDRLDDQRIGVKSSALFFGDQTPKAVGIFFLGTIILLMAEAISLELNIFFWISLLIA 284

Query: 265 LFLTIKRIIALDIS--CSKQCCSFFHSAGVVGILILICLII 303
                 +++ L       ++    F     +G LILI +I+
Sbjct: 285 SLGWFWQVLQLRNPQLPHQEYGKMFSQNVAIGFLILIGMIL 325


>gi|148555277|ref|YP_001262859.1| 4-hydroxybenzoate polyprenyltransferase [Sphingomonas wittichii
           RW1]
 gi|148500467|gb|ABQ68721.1| 4-hydroxybenzoate octaprenyltransferase [Sphingomonas wittichii
           RW1]
          Length = 328

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 138/289 (47%), Gaps = 10/289 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
             + PY  LAR+    G  L   P  W+  LA   + R     W  I W+     +GA+ 
Sbjct: 46  PGLRPYWLLARFDRPIGSWLLFWPGAWAIALAGGAVAR-----WDLILWF----ALGAVA 96

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA C +ND+VD D+D +V RT  RPL SG+     A  +  L  L+  V+L+Q N   
Sbjct: 97  MRGAGCVYNDIVDRDLDRKVARTALRPLASGRIGLRAAWAWLGLLCLVGLVVLVQLNLVA 156

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
                A L     YPF KR    PQ  LG+ F+    VGW A+   FS     L  G+IF
Sbjct: 157 ALAALASLGAVAAYPFMKRITWWPQAWLGLVFSWAALVGWPAVTGGFSPVQGLLYAGSIF 216

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
           WV+ +DT+YA QD +DD L GV S+AR      +  + I YG+ + C++ AF LL     
Sbjct: 217 WVIGYDTIYALQDVEDDALAGVKSSARALGAHARAGIGIFYGLALGCWIAAFWLLRPQLL 276

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI-LICLIIS 304
             + LL        ++  L I       + F +    G+L+ L CL++ 
Sbjct: 277 GTLALLPMALHLAWQVAGLRIDDPADALARFRANRFAGLLMFLACLVVG 325


>gi|209545228|ref|YP_002277457.1| 4-hydroxybenzoate polyprenyl transferase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532905|gb|ACI52842.1| 4-hydroxybenzoate polyprenyl transferase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 305

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 139/287 (48%), Gaps = 11/287 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LAR     G  L  LP +W  +LA+    R       T    + ++ +G++V R A
Sbjct: 25  PYALLARLDRPIGTWLLFLPGMWGILLASGVDAR-------TRLRLIVLFGIGSVVMRSA 77

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C  ND+ D DID  V RT  RPL SG     QA +F      I  V+LLQ NP    +G
Sbjct: 78  GCVVNDMWDRDIDRLVARTAGRPLASGALRMRQAALFLAGLLAIGLVILLQLNPLARVLG 137

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL--HASFSWPAFFLCIGTIFWV 198
            + L +  LYP +KRF   PQ+V+G  F  G  +G+ A       +W A +    TI W 
Sbjct: 138 ASSLILVGLYPLAKRFTWWPQLVMGFTFGFGAPLGYAAATGRVDAAWGALYAA--TILWQ 195

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + FDT+Y  QD +DD  IGV ST+RL++ Q +L++   Y + V   ++A  L       W
Sbjct: 196 LGFDTIYGFQDMEDDARIGVKSTSRLWAGQPRLFVGACYALAVAALLLAGWLAGCGAGFW 255

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
           I + +       ++  LD +   +C S F      G+ I + ++  L
Sbjct: 256 IAMALPTIALAWQVAQLDSTDPARCLSLFRFNRETGLAIALAILAGL 302


>gi|307245684|ref|ZP_07527770.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307254651|ref|ZP_07536480.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307259098|ref|ZP_07540828.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306853386|gb|EFM85605.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306862396|gb|EFM94361.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306866765|gb|EFM98623.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 293

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 100/315 (31%), Positives = 151/315 (47%), Gaps = 32/315 (10%)

Query: 1   MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGW 60
           M+ FF   + R+  +      Y  L R+    G  L + P LW+   AA  +    VL  
Sbjct: 1   MTTFFQQHFSRNKWLA-----YAQLMRFDKPIGTLLLLYPTLWALFAAAGGMPPLSVL-- 53

Query: 61  STIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVL 120
                   I+++G IV R A C  ND  D  ID +V RT  RPL +G+ T  +A +  VL
Sbjct: 54  -------VIFVLGVIVMRAAGCVINDYADRHIDGEVKRTSQRPLATGRVTTAEAKILFVL 106

Query: 121 QFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALH 180
              I+FVL L  N +   + F  + ++++YPF KRF   PQVVLG+ F   + + +GA+ 
Sbjct: 107 LLCIAFVLDLLLNRYTFLLSFVAVALAIIYPFMKRFTHLPQVVLGMAFGWAIPMAYGAVS 166

Query: 181 ASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFS-YQTKLWLFILYGI 239
            S     + L    IFW V +DT YA  D+ DD  IGV STA LF+ Y  K  +  L   
Sbjct: 167 ESLPLECWLLFFANIFWTVAYDTQYAMVDRDDDLRIGVKSTAILFAQYDNK--IIALLQF 224

Query: 240 FVLCFMVAFCLLTV---NFFAWIGLLIALF-----LTIKRIIALDISCSKQCCSFFHSAG 291
             L  +V F  ++     +F  +GL  +LF     LT +R+        +QC   F +  
Sbjct: 225 ITLVLLVIFGWISQYHWGYFVVLGLSASLFSHQCWLTKQRV-------REQCFKAFLNNH 277

Query: 292 VVGILILICLIISLF 306
             G+ +   +++ ++
Sbjct: 278 YFGLGVFFAILVGIY 292


>gi|165976238|ref|YP_001651831.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|189036981|sp|B0BPA2|UBIA_ACTPJ RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|165876339|gb|ABY69387.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
          Length = 293

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 100/315 (31%), Positives = 151/315 (47%), Gaps = 32/315 (10%)

Query: 1   MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGW 60
           M+ FF   + R+  +      Y  L R+    G  L + P LW+   AA  +    VL  
Sbjct: 1   MTTFFQQHFSRNKWLA-----YAQLMRFDKPIGTLLLLYPTLWALFAAAGGMPPLSVL-- 53

Query: 61  STIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVL 120
                   I+++G IV R A C  ND  D  ID +V RT  RPL +G+ T  +A +  VL
Sbjct: 54  -------VIFVLGVIVMRAAGCVINDYADRHIDGEVKRTSQRPLATGRVTTTEAKILFVL 106

Query: 121 QFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALH 180
              I+FVL L  N +   + F  + ++++YPF KRF   PQVVLG+ F   + + +GA+ 
Sbjct: 107 LLCIAFVLDLLLNRYTFLLSFVAVALAIIYPFMKRFTHLPQVVLGMAFGWAIPMAYGAVS 166

Query: 181 ASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFS-YQTKLWLFILYGI 239
            S     + L    IFW V +DT YA  D+ DD  IGV STA LF+ Y  K  +  L   
Sbjct: 167 ESLPLECWLLFFANIFWTVAYDTQYAMVDRDDDLRIGVKSTAILFAQYDNK--IIALLQF 224

Query: 240 FVLCFMVAFCLLTV---NFFAWIGLLIALF-----LTIKRIIALDISCSKQCCSFFHSAG 291
             L  +V F  ++     +F  +GL  +LF     LT +R+        +QC   F +  
Sbjct: 225 ITLVLLVIFGWISQYHWGYFVVLGLSASLFSHQCWLTKQRV-------REQCFKAFLNNH 277

Query: 292 VVGILILICLIISLF 306
             G+ +   +++ ++
Sbjct: 278 YFGLGVFFAILVGIY 292


>gi|260753994|ref|YP_003226887.1| 4-hydroxybenzoate polyprenyltransferase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258553357|gb|ACV76303.1| 4-hydroxybenzoate polyprenyl transferase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 318

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 89/243 (36%), Positives = 122/243 (50%), Gaps = 2/243 (0%)

Query: 65  WYLF-IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
           W+L   + VGA V R A C +ND+VD D+D +V RTR+RPL SG  +   A +F     L
Sbjct: 69  WFLLPAFFVGAFVMRSAGCVYNDIVDRDLDKKVARTRNRPLASGFISVKAACLFIAFLCL 128

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           I    L  FNP       A L +   YPF KR    PQ  LG+ F+    VG  A+   F
Sbjct: 129 IGLGCLAFFNPIARFTAIASLALVAAYPFMKRISWWPQAWLGLVFSWAALVGSVAIWDRF 188

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
            WP  FL  G IFWV+ FDTVYA QD +DD L G+ S+AR      +L + + + + VL 
Sbjct: 189 EWPGIFLYGGCIFWVIGFDTVYAIQDIEDDALAGIKSSARALKSHLRLGVSLFFVLAVLG 248

Query: 244 FMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVG-ILILICLI 302
           +  A         A + LL  +   I ++  LD++  +     F S   +G +L L C  
Sbjct: 249 WSAAIWFTRPQPLALLTLLPVVLHFIWQMTTLDVNDGQNALMRFRSNRQIGFLLFLACAT 308

Query: 303 ISL 305
           I +
Sbjct: 309 IGM 311


>gi|186684770|ref|YP_001867966.1| 4-hydroxybenzoate polyprenyltransferase [Nostoc punctiforme PCC
           73102]
 gi|186467222|gb|ACC83023.1| 4-hydroxybenzoate polyprenyl transferase [Nostoc punctiforme PCC
           73102]
          Length = 293

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 123/245 (50%), Gaps = 15/245 (6%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAY---PLRRAGVLGWSTIFWYLFIYIVGAIVTRG 79
           + L RWH   G  + ++P LW+  LAA    PL   GV+            I+G + T  
Sbjct: 17  IRLLRWHKPEGRLILMIPALWAVFLAASGKPPLPLVGVI------------ILGTLATSA 64

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICV 139
           A C  NDL D DID +V RTR RPL S   +    +V A++    + +L    NP    +
Sbjct: 65  AGCVVNDLWDRDIDPEVERTRDRPLASRALSVKVGIVVAIVSLACAAILAFYLNPLSFWL 124

Query: 140 GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVV 199
             A + + +LYP +KR    PQ+VL I +  GV + W A+  + + P + L   T+ W +
Sbjct: 125 CVAAVPVIVLYPGAKRVFPVPQLVLSIAWGFGVLISWSAVTQTITQPTWLLWGATVLWTL 184

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
            FDTVYA  DK+DD  IGVNS+A  F     + + I +   +L       L+ ++F  WI
Sbjct: 185 GFDTVYAMSDKEDDRRIGVNSSALFFGNYAPVAIGIFFAGTILLLAWLGLLINLHFAFWI 244

Query: 260 GLLIA 264
            L +A
Sbjct: 245 SLAVA 249


>gi|119512608|ref|ZP_01631684.1| 4-hydroxybenzoate polyprenyl transferase [Nodularia spumigena
           CCY9414]
 gi|119462741|gb|EAW43702.1| 4-hydroxybenzoate polyprenyl transferase [Nodularia spumigena
           CCY9414]
          Length = 294

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 124/245 (50%), Gaps = 15/245 (6%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAY---PLRRAGVLGWSTIFWYLFIYIVGAIVTRG 79
           + L RWH   G  + ++P LW+  LAA    PL   GV+            ++G + T  
Sbjct: 17  IRLLRWHKPEGRLILMIPALWAVFLAASGKPPLPLVGVI------------VLGTLATSA 64

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICV 139
           A C  NDL D +ID +V RTR+RPL S   +    +V A++  + +  L L  NP    +
Sbjct: 65  AGCVVNDLWDRNIDPEVERTRNRPLASRALSIKVGIVVAIVSLVCAAALALYLNPLSFWL 124

Query: 140 GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVV 199
             A + + L YP +KR    PQ+VL I +   V + W A+  + S P + L   TI W +
Sbjct: 125 SVAAVPVILFYPGAKRVFPVPQLVLSIAWGFAVLISWSAVTPTLSQPTWLLWGATILWTL 184

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
            FDTVYA  D++DD  IGVNS+A  F +     + I +   V+  +    L+ +NF  W+
Sbjct: 185 GFDTVYAMSDREDDRRIGVNSSALFFGHYAPTAIGIFFVTTVILLIRLGLLINLNFTFWV 244

Query: 260 GLLIA 264
            L IA
Sbjct: 245 SLGIA 249


>gi|262276807|ref|ZP_06054600.1| 4-hydroxybenzoate polyprenyl transferase [alpha proteobacterium
           HIMB114]
 gi|262223910|gb|EEY74369.1| 4-hydroxybenzoate polyprenyl transferase [alpha proteobacterium
           HIMB114]
          Length = 286

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 95/292 (32%), Positives = 144/292 (49%), Gaps = 14/292 (4%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLW--STVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           +  Y+ L R     G+ L   PC W  +  L+  P+       W   F YL ++ +GA++
Sbjct: 1   MKNYLLLMRLDKPIGFMLLFWPCSWGFAIALSKRPIDNE----W---FLYLLLFFIGAVL 53

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA--LVFAVLQFLISFVLLLQFNP 134
            R A C +ND+VD  ID +V RT+SRP+ S + +   A  L+ A+  F  S  +LLQFN 
Sbjct: 54  MRSAGCVYNDIVDRKIDQKVERTKSRPIASKKISLKNAWILIIALCSF--SLAILLQFNL 111

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT 194
             I  G A   + + YPF KR    PQ+ LGI F  GV + +       ++      I  
Sbjct: 112 NAILFGLASGLLIICYPFMKRITYWPQLFLGIVFNWGVILSYLVFFGKINFEIILFYISA 171

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGI-FVLCFMVAFCLLTV 253
           I W + +DT+Y  QD +DD  IGV STA  F    KL+L ++Y   FV+  +  F ++ +
Sbjct: 172 ILWTLGYDTIYGMQDLEDDLKIGVKSTAIKFKKNIKLFLSLVYSFSFVILIIANFLIVGL 231

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
               +I  LI + L I +I  +  + + +  S F      G+ I I  I+ L
Sbjct: 232 IKIEFIFYLIPMSLLIYQIRLVKTNNNSKNLSLFKLNNYYGLSIFIIQILVL 283


>gi|260222582|emb|CBA32286.1| 4-hydroxybenzoate octaprenyltransferase [Curvibacter putative
           symbiont of Hydra magnipapillata]
          Length = 298

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 87/284 (30%), Positives = 142/284 (50%), Gaps = 10/284 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L RW+   GW L + P L +  LAA      G  GW  I     ++ +G I+ R A 
Sbjct: 20  YLDLIRWNRPAGWLLLLWPTLSALWLAA-----GGFPGWHLIT----VFTLGTILMRSAG 70

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND+ D + D  V RT  RP+ SG+ +  +AL    +  L +F L+L  N   I   F
Sbjct: 71  CCVNDVADREFDKHVKRTAQRPVTSGRISSREALAVGAVLALAAFGLVLTTNAVTIASSF 130

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++L+YP++KR +  PQ VLG+ F+ G+ + + A+ A   W A+ L +G +FWV+ +
Sbjct: 131 AALAVALVYPYAKRHVSMPQAVLGVAFSFGIPMAYAAVRADVPWQAWALLVGNLFWVLAY 190

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFM-VAFCLLTVNFFAWIG 260
           DT YA  D+ DD  IG+ ++A        + +   YG+++L +  +    L   +  W+G
Sbjct: 191 DTEYAMVDRDDDLRIGIKTSAITLGRWDVVAVLAFYGVYLLIWTWLVLPGLREAWGWWLG 250

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           +  A+   +     +     + C   F     VG  +   ++IS
Sbjct: 251 VAAAIVQVVWHGTLIKDRSREGCFKAFRLNHWVGFAVFAGIVIS 294


>gi|218201090|gb|EEC83517.1| hypothetical protein OsI_29101 [Oryza sativa Indica Group]
          Length = 419

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 89/218 (40%), Positives = 113/218 (51%), Gaps = 10/218 (4%)

Query: 18  AIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVT 77
           A  PY  LAR     G  L   P  WS  +AA P       G       L ++  G+++ 
Sbjct: 135 AARPYAMLARIDKPVGTWLLAWPSFWSIAMAAMP-------GELPDMRMLALFACGSVLI 187

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           RGA CT NDL+D DID +V RT+SRPL SG  T  Q + F   Q L+   +LLQ N    
Sbjct: 188 RGAGCTINDLLDRDIDRKVERTKSRPLASGILTPTQGVGFLGFQLLLGLPILLQLNNLSQ 247

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT--I 195
            +G   L +   YP  KRF   PQ  LG+ F  G  +GW A+  +   PA  L + T  I
Sbjct: 248 ILGVFSLLLVFSYPLMKRFTYWPQAYLGLVFNWGALIGWAAMKGTID-PAIILPLYTAGI 306

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
            W + +DT+YAHQDK+DD  IGV STA  F   TK W+
Sbjct: 307 CWTLVYDTIYAHQDKEDDVKIGVKSTALRFGDSTKPWI 344


>gi|46143432|ref|ZP_00204469.1| COG0382: 4-hydroxybenzoate polyprenyltransferase and related
           prenyltransferases [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126208298|ref|YP_001053523.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae L20]
 gi|190150148|ref|YP_001968673.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|303251320|ref|ZP_07337498.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303252820|ref|ZP_07338979.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307247807|ref|ZP_07529843.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307252445|ref|ZP_07534341.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307256872|ref|ZP_07538650.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307261304|ref|ZP_07542979.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|307263485|ref|ZP_07545100.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|189036980|sp|A3N0I2|UBIA_ACTP2 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790259|sp|B3H1F9|UBIA_ACTP7 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|126097090|gb|ABN73918.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|189915279|gb|ACE61531.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|302648250|gb|EFL78447.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302649862|gb|EFL80040.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306855609|gb|EFM87776.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306860037|gb|EFM92054.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306864606|gb|EFM96511.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306869035|gb|EFN00837.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306871128|gb|EFN02857.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 293

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 100/315 (31%), Positives = 151/315 (47%), Gaps = 32/315 (10%)

Query: 1   MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGW 60
           M+ FF   + R+  +      Y  L R+    G  L + P LW+   AA  +    VL  
Sbjct: 1   MTTFFQQHFSRNKWLA-----YAQLMRFDKPIGTLLLLHPTLWALFAAAGGMPPLSVL-- 53

Query: 61  STIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVL 120
                   I+++G IV R A C  ND  D  ID +V RT  RPL +G+ T  +A +  VL
Sbjct: 54  -------VIFVLGVIVMRAAGCVINDYADRHIDGEVKRTSQRPLATGRVTTTEAKILFVL 106

Query: 121 QFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALH 180
              I+FVL L  N +   + F  + ++++YPF KRF   PQVVLG+ F   + + +GA+ 
Sbjct: 107 LLCIAFVLDLLLNRYTFLLSFVAVALAIIYPFMKRFTHLPQVVLGMAFGWAIPMAYGAVS 166

Query: 181 ASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFS-YQTKLWLFILYGI 239
            S     + L    IFW V +DT YA  D+ DD  IGV STA LF+ Y  K  +  L   
Sbjct: 167 ESLPLECWLLFFANIFWTVAYDTQYAMVDRDDDLRIGVKSTAILFAQYDNK--IIALLQF 224

Query: 240 FVLCFMVAFCLLTV---NFFAWIGLLIALF-----LTIKRIIALDISCSKQCCSFFHSAG 291
             L  +V F  ++     +F  +GL  +LF     LT +R+        +QC   F +  
Sbjct: 225 ITLVLLVIFGWISQYHWGYFVVLGLSASLFSHQCWLTKQRV-------REQCFKAFLNNH 277

Query: 292 VVGILILICLIISLF 306
             G+ +   +++ ++
Sbjct: 278 YFGLGVFFAILVGIY 292


>gi|329114601|ref|ZP_08243360.1| 4-hydroxybenzoate octaprenyltransferase [Acetobacter pomorum DM001]
 gi|326696081|gb|EGE47763.1| 4-hydroxybenzoate octaprenyltransferase [Acetobacter pomorum DM001]
          Length = 305

 Score =  132 bits (333), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 95/288 (32%), Positives = 144/288 (50%), Gaps = 7/288 (2%)

Query: 18  AIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVT 77
           A+  Y  LAR     G  L  LP +W  +L        GV  +  I   + ++ +G++V 
Sbjct: 22  ALQAYALLARLDRPIGTWLLWLPGMWGILLPQ------GVATFERIR-LIVLFGIGSLVM 74

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           R A C  ND+ D DID QV RT  RPL SG  +  QA +F VL  L    +L+Q N    
Sbjct: 75  RAAGCVVNDMWDRDIDRQVARTAGRPLASGALSMKQATLFLVLLLLAGLAVLVQLNTLSW 134

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFW 197
            +G + L +  LYP +KRF   PQ+V+G  F  G  +G+ A     SW    L   TI W
Sbjct: 135 VLGVSSLLLVALYPLAKRFTWWPQLVMGFTFGFGAPMGYAAAAGHLSWAQAALYAATIVW 194

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFA 257
            + FDT+Y  QD +DD  IGV ST+RL   + + ++   YG+ ++   VA  L  V    
Sbjct: 195 QLGFDTIYGFQDMEDDARIGVKSTSRLMVGRARGFIGTCYGLMLVLLAVAAVLAGVGLLF 254

Query: 258 WIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
           W+ L++   L  ++ + +D +    C + F +   +G+ + + L+  L
Sbjct: 255 WVALVVPAILLWQQALKVDPTSPALCLAQFRANREIGLAVALALVAGL 302


>gi|209549823|ref|YP_002281740.1| 4-hydroxybenzoate polyprenyltransferase [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209535579|gb|ACI55514.1| 4-hydroxybenzoate polyprenyl transferase [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 304

 Score =  132 bits (333), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 83/263 (31%), Positives = 129/263 (49%), Gaps = 10/263 (3%)

Query: 1   MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGW 60
           +S   +  WV D  + +A  PY  LAR     G  L + PC  + + A+  L   G    
Sbjct: 9   LSDIHHGDWV-DRRLPAAWRPYTRLARLDRPVGIWLTLFPCWAALIQASRGLPDLG---- 63

Query: 61  STIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVL 120
                 L I+ +GA++ R A  T ND+ D + D+ V RTR RPL SG     QA VF   
Sbjct: 64  -----ELVIFSLGALLMRSAGSTVNDIADRNFDAHVERTRFRPLASGDIGTLQAFVFLAA 118

Query: 121 QFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALH 180
           + +++  LL    P+   +  ++L +  +YP  KR    PQ VL   F  G+ + W  + 
Sbjct: 119 ELMLAASLLFFLTPYTRLIAISVLPLVFVYPLCKRITHWPQAVLSAAFNWGMLMAWAEIA 178

Query: 181 ASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIF 240
                 A  +  G I W + +DTVYA+ D +DD  +G+ STA LF  + K+W+ + Y + 
Sbjct: 179 GHIPAGAVLMWAGAIAWQIGYDTVYAYVDVRDDTRLGLKSTAILFGRRGKMWIGLFYALA 238

Query: 241 VLCFMVAFCLLTVNFFAWIGLLI 263
           V  + +   LL ++    IG+L+
Sbjct: 239 VAAWSIGGWLLEMSPPYAIGMLV 261


>gi|307250053|ref|ZP_07532017.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306857913|gb|EFM90005.1| 4-hydroxybenzoate octaprenyltransferase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
          Length = 293

 Score =  132 bits (333), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 100/315 (31%), Positives = 151/315 (47%), Gaps = 32/315 (10%)

Query: 1   MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGW 60
           M+ FF   + R+  +      Y  L R+    G  L + P LW+   AA  +    VL  
Sbjct: 1   MTTFFQQHFSRNKWLA-----YAQLMRFDKPIGTLLLLHPTLWALFAAAGGMPPLSVL-- 53

Query: 61  STIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVL 120
                   I+++G IV R A C  ND  D  ID +V RT  RPL +G+ T  +A +  VL
Sbjct: 54  -------VIFVLGVIVMRAAGCVINDYADRHIDGEVKRTSQRPLATGRVTTTEAKILFVL 106

Query: 121 QFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALH 180
              I+FVL L  N +   + F  + ++++YPF KRF   PQVVLG+ F   + + +GA+ 
Sbjct: 107 LLCIAFVLDLLLNRYTFLLSFVAVALAIIYPFMKRFTHLPQVVLGMAFGWAIPMAYGAVS 166

Query: 181 ASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFS-YQTKLWLFILYGI 239
            S     + L    IFW V +DT YA  D+ DD  IGV STA LF+ Y  K  +  L   
Sbjct: 167 ESLPLECWLLFFANIFWTVAYDTQYAMVDRDDDLRIGVKSTAILFAQYDNK--IIALLQF 224

Query: 240 FVLCFMVAFCLLTV---NFFAWIGLLIALF-----LTIKRIIALDISCSKQCCSFFHSAG 291
             L  +V F  ++     +F  +GL  +LF     LT +R+        +QC   F +  
Sbjct: 225 ITLVLLVIFGWISQYHWGYFVVLGLSASLFIHQCWLTKQRV-------REQCFKAFLNNH 277

Query: 292 VVGILILICLIISLF 306
             G+ +   +++ ++
Sbjct: 278 YFGLGVFFAILVGIY 292


>gi|254788365|ref|YP_003075794.1| 4-hydroxybenzoate polyprenyl transferase [Teredinibacter turnerae
           T7901]
 gi|237684285|gb|ACR11549.1| 4-hydroxybenzoate polyprenyl transferase [Teredinibacter turnerae
           T7901]
          Length = 296

 Score =  132 bits (332), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 95/282 (33%), Positives = 137/282 (48%), Gaps = 11/282 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L R H   G +L + P LWS  LAA      GV  W      L I+ VG ++ R A 
Sbjct: 19  YLQLMRLHRPIGIYLVLWPTLWSLWLAA-----GGVPRWD----LLVIFTVGVVLMRSAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQ-ALVFAVLQFLISFVLLLQFNPFVICVG 140
           C  ND  D  +D  V RTRSRPL +G  +  + A +FAVL  L SF+L+LQ N   + + 
Sbjct: 70  CVINDYADRKVDGHVERTRSRPLVTGLVSPVEAAALFAVLS-LASFLLVLQTNDLTVYLS 128

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              + ++  YPF KR+   PQVVLG  FA  V + + A     S   + L    + W V 
Sbjct: 129 VGGIALAFCYPFMKRYTQLPQVVLGAAFAWSVPMAFAAQTGELSSHIWLLYTAVLLWTVA 188

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT YA  D+ DD  IGV S+A LF  Q K     L  + ++  ++      +  F ++ 
Sbjct: 189 YDTFYAMVDRDDDLKIGVKSSAILFGEQDKAITACLQMMTLIALLMVGTKFELGTFYYLS 248

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           L  A  L I + + +       C   F +   VGI+I + ++
Sbjct: 249 LAAAAGLMIYQQLLIRERQRDACFKAFLNNNWVGIVIFVGIV 290


>gi|187476622|ref|YP_784645.1| 4-hydroxybenzoate octaprenyltransferase [Bordetella avium 197N]
 gi|115421208|emb|CAJ47713.1| putative 4-hydroxybenzoate--polyprenyl transferase [Bordetella
           avium 197N]
          Length = 327

 Score =  132 bits (332), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 91/288 (31%), Positives = 141/288 (48%), Gaps = 11/288 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L +LPC+ + V AA         GW  + W L I+ +GA++ RG 
Sbjct: 50  PYARLCRLDRPIGTWLTLLPCIAALVQAAG--------GWPDV-WRLIIFSLGALLMRGI 100

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT ND+ D DID  V RTR RPL SGQ +  QA+ F + Q L+   LL   N       
Sbjct: 101 GCTVNDMWDRDIDKHVERTRFRPLTSGQLSMRQAVWFLLGQLLVCASLLFFINDLSRWWA 160

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
             +L    +YPF KR    PQ VLG+ F  G+ + W             + +G + W + 
Sbjct: 161 LGVLPFVFIYPFCKRVTYWPQAVLGVCFNWGMLMAWTDTQNHLPLAGVAMWLGAVLWQIG 220

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +D++YA+ D +DD  +G++STA  F+ Q K W+   Y    L +  A   + + +  ++G
Sbjct: 221 YDSIYAYVDVRDDRKLGLHSTAMRFADQGKRWIGGFYLASALLWAWAGYAMGMGWTYFVG 280

Query: 261 L-LIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
           + L+AL LT + ++  D+    +    F +    G+L++   +    L
Sbjct: 281 MALVALHLTWQ-LLVFDLRRPDRNFMLFRANLWTGVLLIASALAGTLL 327


>gi|56552315|ref|YP_163154.1| 4-hydroxybenzoate polyprenyltransferase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56543889|gb|AAV90043.1| 4-hydroxybenzoate polyprenyl transferase [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 318

 Score =  132 bits (332), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 88/243 (36%), Positives = 122/243 (50%), Gaps = 2/243 (0%)

Query: 65  WYLF-IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
           W+L   + +GA V R A C +ND+VD D+D +V RTR+RPL SG  +   A +F     L
Sbjct: 69  WFLLPAFFIGAFVMRSAGCVYNDIVDRDLDKKVARTRNRPLASGFISVKAACLFIAFLCL 128

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           I    L  FNP       A L +   YPF KR    PQ  LG+ F+    VG  A+   F
Sbjct: 129 IGLGCLTFFNPIARFTAIASLALVAAYPFMKRISWWPQAWLGLVFSWAALVGSVAIWDRF 188

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
            WP  FL  G IFWV+ FDTVYA QD +DD L G+ S+AR      +L + + + + VL 
Sbjct: 189 EWPGIFLYGGCIFWVIGFDTVYAIQDIEDDALAGIKSSARALKSHLRLGVSLFFVLAVLG 248

Query: 244 FMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVG-ILILICLI 302
           +  A         A + LL  +   I ++  LD++  +     F S   +G +L L C  
Sbjct: 249 WGAAIWFTRPQPLALLTLLPVVLHFIWQMTTLDVNDGQNALMRFRSNRQIGFLLFLACAT 308

Query: 303 ISL 305
           I +
Sbjct: 309 IGM 311


>gi|50311051|ref|XP_455549.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49644685|emb|CAG98257.1| KLLA0F10307p [Kluyveromyces lactis]
          Length = 371

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 139/286 (48%), Gaps = 14/286 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           + + PY  L R     G  L  +PC W+  +AA  +  A  LG  +  W L ++ VGA++
Sbjct: 77  TKLIPYAELMRLEKPVGTWLLYIPCTWAITMAA--METAAPLG--STLWMLALFGVGALI 132

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT NDL+D ++D++V+R+  RP+ SG+ +  +A+VF   Q  I   +L Q     
Sbjct: 133 MRGAGCTINDLLDRNLDNKVIRSVERPIASGRVSPGKAVVFLGAQTAIGMGILAQLPADC 192

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTI 195
             +G A L I   YP  KRF   PQ  L   F  G  +G+ A+     W     L + T 
Sbjct: 193 WYLGLASLPIVFTYPLFKRFTYYPQAALSACFNWGSLLGFPAM-GLMDWSTMIPLYVSTY 251

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFIL----YGIFVLCFMVAFCLL 251
            W + +DT+YAHQDKK D   G+ STA  +   TK     L     G   L  + +  LL
Sbjct: 252 IWCMIYDTIYAHQDKKFDIKAGIKSTALAWGKNTKKICTALGTVQIGTLALAGLNSGLLL 311

Query: 252 TVNFFAWIGLLI-ALFLTIKRIIALDISCSKQCCSFFHSAGVVGIL 296
              F   +G+    LF  I+R+   D++    C  +F S    GI+
Sbjct: 312 GPGFLCGLGIFTYRLFDMIRRV---DLNDPADCWKWFQSNINTGII 354


>gi|58698396|ref|ZP_00373308.1| 4-hydroxybenzoate polyprenyl transferase [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58535078|gb|EAL59165.1| 4-hydroxybenzoate polyprenyl transferase [Wolbachia endosymbiont of
           Drosophila ananassae]
          Length = 265

 Score =  131 bits (330), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 125/244 (51%), Gaps = 5/244 (2%)

Query: 55  AGVLGWSTIFWY-----LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQC 109
           +G+L  ST   Y     L ++ +GA + R A C  ND+ D  ID+ V RT+ RPL SG  
Sbjct: 7   SGILLASTSLSYQALFLLVLFTIGAFLMRPAGCIINDIFDRKIDAHVERTKYRPLASGAL 66

Query: 110 TRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFA 169
              QAL    L   I+ V+LL  N   + +G   + +   YP  KR++  PQ+ LG  F 
Sbjct: 67  NIKQALALLSLLLSIALVILLLTNKTTLILGIISMCMIATYPLLKRYVWWPQLFLGFTFN 126

Query: 170 GGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQT 229
            G  +G  A+    S  +    IG +FW + +DT+YAHQDKKDDE +G+ STA  F   T
Sbjct: 127 MGSLMGSAAITNQISIESLLFYIGCVFWTLSYDTIYAHQDKKDDEKLGMKSTALYFGDTT 186

Query: 230 KLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHS 289
           K WL   Y I ++ ++ A  L ++N   +I LL   F+  ++    +     QC S F +
Sbjct: 187 KSWLKRFYLISLMTWLYAGILSSLNNIFYIALLAVGFIFHRQCKNFNPDDPSQCMSIFKN 246

Query: 290 AGVV 293
              V
Sbjct: 247 NSYV 250


>gi|269961503|ref|ZP_06175866.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio harveyi 1DA3]
 gi|269833732|gb|EEZ87828.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio harveyi 1DA3]
          Length = 284

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 87/288 (30%), Positives = 142/288 (49%), Gaps = 19/288 (6%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P +W+ V+AA      G+  W+     L ++++G  + R A 
Sbjct: 9   YWQLMRMDRPIGSLLLLWPTVWALVIAA-----QGIPSWNV----LIVFVLGVFLMRSAG 59

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT+ RPLPSG+ T  +A+   ++  + SF+L+L  NP  I + F
Sbjct: 60  CVINDFADRKVDGHVKRTKQRPLPSGKVTSKEAIGLFLVLGISSFLLVLTMNPLTIKLSF 119

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A +F++ +YPF KR+   PQ+ LG+ F+  + + W A         +F+      W + +
Sbjct: 120 AGIFLAFIYPFMKRYTHLPQLFLGLAFSWAIPMAWAAQTGELPLIVWFVFAINALWTIAY 179

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF-----F 256
           DT YA  D+ DD  IG+ STA LF    KL    + G+  L  +    LL  ++     +
Sbjct: 180 DTQYAMVDRDDDLKIGIKSTAILFGRHDKL----VIGVLQLITLAMLVLLGQHYELGQSY 235

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            W  +L+A  L + +   +       C   F +   VG++I + L+I+
Sbjct: 236 YWT-ILVAASLFVYQQHLIRHRDRDLCFRAFLNNNYVGMVIAVGLVIA 282


>gi|241763508|ref|ZP_04761560.1| 4-hydroxybenzoate polyprenyl transferase [Acidovorax delafieldii
           2AN]
 gi|241367239|gb|EER61579.1| 4-hydroxybenzoate polyprenyl transferase [Acidovorax delafieldii
           2AN]
          Length = 289

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 119/235 (50%), Gaps = 21/235 (8%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L RW    GW + V P L +  LAA      G  GW      L ++++G ++ R A 
Sbjct: 12  YLDLVRWDRPAGWLVLVWPTLSALWLAA-----GGFPGWH----LLAVFVLGTVLMRSAG 62

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND+ D D D  V RT  RP+ SGQ +  +AL    +  LIS  L+L  N   +    
Sbjct: 63  CCINDVADRDFDRHVKRTAQRPITSGQVSVKEALAVGAVLSLISLGLVLTTNAVAVAWSV 122

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L +++LYPF+KRF   PQ VLGI F  G+ + + A+       A+ L +G +FWV+ +
Sbjct: 123 PALLVTILYPFTKRFFAMPQAVLGIAFNFGIVIAFAAVQRQVPATAWLLWLGNLFWVLAY 182

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
           DT YA  D+ DD  IG+ ++A            I  G F +  +V F LL V F+
Sbjct: 183 DTEYAMVDRDDDLKIGMKTSA------------ITLGRFDVAAIVVFYLLFVGFW 225


>gi|158957517|gb|ABD59796.2| geranyl diphosphate:4-hydroxybenzoate geranyltransferase [Arnebia
           euchroma]
          Length = 306

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 95/301 (31%), Positives = 142/301 (47%), Gaps = 24/301 (7%)

Query: 12  DCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAA----YPLRRAGVLGWSTIFWYL 67
           +  +   + PY +LAR     G  L   P  WS  L A     P +   + GW    W +
Sbjct: 18  ELYLPKEVRPYAHLARLDKPIGSWLLAWPAFWSVALVADFGSLP-KMLAIFGW----WAV 72

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
           +I        RGA CT ND  D D D +V RT+SRPL SG  +  Q L +   Q  I   
Sbjct: 73  WI--------RGAGCTINDYFDRDFDKKVERTKSRPLASGAVSPSQGLWWLAFQLFIGLG 124

Query: 128 LLLQFNPFVICVGFALLFISLL--YPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW 185
           +L QFN  ++ +  A+L + L+  YP  KR    PQ  LG+  + G  +G  AL  S   
Sbjct: 125 VLYQFN--ILTLALAILHVPLVFAYPLMKRITYWPQAFLGVMISWGALLGSSALKGSVV- 181

Query: 186 P--AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
           P  A+ L I + FW + +DT+YAHQDK DD   G+ STA  F   TK+W+       +  
Sbjct: 182 PSIAYPLYISSFFWTLVYDTIYAHQDKVDDAKAGIKSTALRFGDATKIWISWFGVGCIAA 241

Query: 244 FMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLII 303
            ++   ++ + F  ++ + IA      +I+ +D+S    C   F S    G +I   +++
Sbjct: 242 LVIGGLIVNIGFPYYVFVAIATGQLAWQIVTVDLSSPMDCGRKFVSNQWFGAIIFTGILL 301

Query: 304 S 304
            
Sbjct: 302 G 302


>gi|322514537|ref|ZP_08067570.1| 4-hydroxybenzoate polyprenyl transferase [Actinobacillus ureae ATCC
           25976]
 gi|322119476|gb|EFX91563.1| 4-hydroxybenzoate polyprenyl transferase [Actinobacillus ureae ATCC
           25976]
          Length = 293

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 143/294 (48%), Gaps = 27/294 (9%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R+    G  L + P LW+   AA      GV   S     L I+++G IV R A 
Sbjct: 17  YAQLMRFDKPIGTLLLLHPTLWALFAAA-----GGVPPLSV----LVIFVLGVIVMRAAG 67

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  ID +V RT  RPL +G+ T  +A +   L   I+FVL L  N +   + F
Sbjct: 68  CVINDYADRHIDGEVKRTSQRPLATGRVTTMEAKILFGLLLCIAFVLDLLLNRYTFLLSF 127

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + ++++YPF KRF   PQVVLG+ F   + + +GA+  S     + L    IFW V +
Sbjct: 128 VAVALAIIYPFMKRFTHLPQVVLGMAFGWAIPMAYGAVSESLPLECWLLFFANIFWTVAY 187

Query: 202 DTVYAHQDKKDDELIGVNSTARLFS-YQTKLWLFILYGIFVLCFMVAFCLLTV---NFFA 257
           DT YA  D+ DD  IGV STA LF+ Y  K  +  L     L  +V F  ++     +F 
Sbjct: 188 DTQYAMVDRDDDLRIGVKSTAILFAQYDNK--IIALLQFIALVLLVVFGWISEYHWGYFV 245

Query: 258 WIGLLIALF-----LTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
            +GL   LF     LT +R+        +QC   F +    G+ + + +++ ++
Sbjct: 246 VLGLSACLFSYQCWLTKQRV-------REQCFKAFLNNHYFGLGVFLAILVGIY 292


>gi|33594546|ref|NP_882190.1| 4-hydroxybenzoate octaprenyltransferase [Bordetella pertussis
           Tohama I]
 gi|33564622|emb|CAE43941.1| UbiA prenyltransferase family protein [Bordetella pertussis Tohama
           I]
          Length = 308

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 112/220 (50%), Gaps = 15/220 (6%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAA---YPLRRAGVLGWSTIFWYLFIYIVGAIVT 77
           PY  L R     G  L +LPC+ + V AA     LRR            L I+ +GA++ 
Sbjct: 30  PYARLCRLDRPIGTWLTLLPCIAALVQAAGGLPDLRR------------LLIFSLGALLM 77

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           RG  CT ND+ D DID  V RTR RPL SGQ +  QA+ F + Q L+   LL   N    
Sbjct: 78  RGIGCTVNDMWDRDIDKHVERTRFRPLTSGQLSMRQAVAFLIGQLLVCASLLFFINDMSR 137

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFW 197
            +  A+L    +YPF KR    PQVVLGI F  G+ + W          A  + +G + W
Sbjct: 138 WLAVAVLPFVFIYPFCKRVTYWPQVVLGICFNWGMLMAWSDTQDHLPLAAIAMWLGAVLW 197

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY 237
            V +D++YA+ D +DD  +G++STA  F  Q  LW+   Y
Sbjct: 198 QVGYDSIYAYVDVRDDRSLGLHSTAMRFGEQGMLWIGGFY 237


>gi|330878106|gb|EGH12255.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 296

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/243 (34%), Positives = 122/243 (50%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           +V L R     G +L + P LW+  +A       G     T+F    I++ G  + R A 
Sbjct: 19  FVQLTRIDKPIGIYLLLWPTLWAVWIAG-----KGSPSLKTVF----IFVAGVFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +ALV   +   +SFVL+L  N   I + F
Sbjct: 70  CVINDFADRKVDGHVKRTEQRPLVSGKVSSREALVLFAILVSLSFVLVLFTNSTTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A +      A+ L I  + W V +
Sbjct: 130 GGLALAACYPFMKRYTYYPQVVLGAAFSWGMPMAFTAENGELPAAAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L G+ + C  +A     +  F + GL
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILTLQGLALGCLALAGSRFELGAFFYTGL 249

Query: 262 LIA 264
           LIA
Sbjct: 250 LIA 252


>gi|171688778|ref|XP_001909329.1| hypothetical protein [Podospora anserina S mat+]
 gi|170944351|emb|CAP70461.1| unnamed protein product [Podospora anserina S mat+]
          Length = 401

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 109/216 (50%), Gaps = 10/216 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G +   LPCL+ST+LAA PL  +     ST+  Y  +++ GAI+ RGA
Sbjct: 96  PYAELIRLDKPAGTYYLYLPCLFSTLLAA-PLSHSPP---STVLTYSLLFLSGAIIMRGA 151

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL D ++D  V RTR RP+     T   AL+F   Q L    +LLQF        
Sbjct: 152 GCTINDLWDRNLDPHVTRTRLRPIARRAITPLNALLFTGAQLLTGLAILLQFPTSCFYYA 211

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHAS-FSWPAFFLCIGTIF--- 196
              L +  LYP +KR    PQ VLG+ F+ G  +G+ AL     S  A     G ++   
Sbjct: 212 TPSLLLVTLYPLAKRVTYYPQFVLGLTFSWGAILGFPALGVDLLSNTAALTAAGLLYGSN 271

Query: 197 --WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
             W V +D +YAHQD KDD   G+ S A     +TK
Sbjct: 272 VAWTVLYDMIYAHQDIKDDAKAGIKSIALKHDKETK 307


>gi|73667197|ref|YP_303213.1| prenyltransferase [Ehrlichia canis str. Jake]
 gi|72394338|gb|AAZ68615.1| 4-hydroxybenzoate octaprenyltransferase [Ehrlichia canis str. Jake]
          Length = 292

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 90/288 (31%), Positives = 144/288 (50%), Gaps = 8/288 (2%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S    Y  L R HS     LA+ P L S  L ++ + RA          Y+ + ++GA +
Sbjct: 10  SNFGEYRLLLRLHSVEIIFLAMFPALASIALVSHSVLRA--------CGYMILCVIGAFI 61

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  ND+ D  IDS+V RTR+RPL +G  +  QAL    +    + +LL   N + 
Sbjct: 62  MRPAGCIINDIFDRKIDSKVKRTRNRPLANGNLSVVQALKVLGVLLACACLLLACTNMYT 121

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           + +    + + +LYP SKRF   PQ++LGI F  GV +G        +  A  L IG +F
Sbjct: 122 VKLSIISMILIVLYPLSKRFFTWPQLLLGIVFNSGVLLGCTMTIGHLTLSAVLLYIGCVF 181

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
           W + +DTVYA QDK+ D  +G+ STA  F    +LW+  LY I +  ++ A  +  ++  
Sbjct: 182 WTIGYDTVYAAQDKEYDIELGLQSTAIKFGNDIRLWIGRLYIITITMWISAGIISMLHPI 241

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            +I +LI   +   +    D    ++C   F     VG+++ + +++ 
Sbjct: 242 FYIAILIIGAIFYYQYKKSDFDNPEKCMYMFKVNVYVGLILFLGIVLG 289


>gi|300864207|ref|ZP_07109091.1| 4-hydroxybenzoate polyprenyltransferase [Oscillatoria sp. PCC 6506]
 gi|300337781|emb|CBN54237.1| 4-hydroxybenzoate polyprenyltransferase [Oscillatoria sp. PCC 6506]
          Length = 293

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 116/233 (49%), Gaps = 13/233 (5%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           + L RW    G  + ++P LW+  LA      A ++G         + ++G + T  A C
Sbjct: 16  MRLLRWDKPAGRLILMIPALWAVFLAGRGTPPAPLVG---------VIVLGTLATSAAGC 66

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFA 142
             NDL D DID +V RTRSRPL S   T    +  A++ F+ + VL L  NP    +  A
Sbjct: 67  VVNDLWDRDIDPEVERTRSRPLASRALTIQTGIGVALISFICAAVLALYLNPLSFWLSAA 126

Query: 143 LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFD 202
            + I + YP +KR    PQ+VL I +   V + W AL +    P  FL   T+FW + FD
Sbjct: 127 AVPIIICYPLAKRVFPIPQLVLSIAWGFAVLISWSALVSRLEIPTGFLWGATVFWTLGFD 186

Query: 203 TVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
           TVYA  D++DD+ +GVNS+A  F   +        GIF L  +V      +N 
Sbjct: 187 TVYAMSDREDDQRLGVNSSAIFFGDNSA----NAVGIFFLLTVVLLAATGINM 235


>gi|78486498|ref|YP_392423.1| 4-hydroxybenzoate polyprenyl transferase [Thiomicrospira crunogena
           XCL-2]
 gi|118574231|sp|Q31DM4|UBIA_THICR RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|78364784|gb|ABB42749.1| 4-hydroxybenzoate octaprenyltransferase [Thiomicrospira crunogena
           XCL-2]
          Length = 285

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 90/291 (30%), Positives = 143/291 (49%), Gaps = 9/291 (3%)

Query: 14  IMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVG 73
           I    +  Y+ L R     G +L + P LW+  LAA  +    +L          I+I+G
Sbjct: 2   IHKQQLQAYLQLTRIDRPIGIYLVLWPALWALWLAADGMPPMSIL---------IIFILG 52

Query: 74  AIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFN 133
           A++ R A C  ND  D   D  V RT +RPL +GQ T  QAL F  +  L++F L+L  N
Sbjct: 53  AVIMRSAGCVINDYADRHFDGYVTRTCARPLATGQLTERQALKFFFVLCLLAFGLVLFLN 112

Query: 134 PFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIG 193
           PF I +    + +++LYPF KR    PQ  LG  FA  + + + A+     W A+ +   
Sbjct: 113 PFTILLSLGAVGLAILYPFMKRHTFWPQAFLGAAFAWAIPMAFAAIQNQVPWQAWVIFGV 172

Query: 194 TIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTV 253
           T+ W + +DT YA  DK+DD  +G+ STA LF  + +  +     I +L F+    L  +
Sbjct: 173 TLVWALVYDTAYAVADKEDDVKLGIKSTAILFGDRVQEIIGFFQAIMLLGFLWIGDLFGL 232

Query: 254 NFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           ++  +  +LIA    +     L     ++    F +   VG++ILI +++ 
Sbjct: 233 SWLYYGSVLIAAGFFVYHQYLLSFDQPQKAFKAFLNNHWVGLVILIGIMLD 283


>gi|330967970|gb|EGH68230.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 296

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 85/243 (34%), Positives = 122/243 (50%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           +V L R     G +L + P LW+  +A       G    +T+F    I++ G  + R A 
Sbjct: 19  FVQLTRIDKPIGIYLLLWPTLWAVWIAG-----KGSPSLNTVF----IFVAGVFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +ALV   +   +SFVL+L  N   I + F
Sbjct: 70  CVINDFADRKVDGHVKRTEQRPLVSGKVSSREALVLFAILVSLSFVLVLFTNSTTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAACYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGELPAAAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L G+ + C  +A     +  F + GL
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILTLQGLALGCLALAGSRFELGAFFYTGL 249

Query: 262 LIA 264
           LIA
Sbjct: 250 LIA 252


>gi|195984475|gb|ACG63821.1| UbiA [Aphanizomenon sp. NH-5]
          Length = 293

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 93/291 (31%), Positives = 140/291 (48%), Gaps = 21/291 (7%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAY---PLRRAGVLGWSTIFWYLFIYIVGAIVTRG 79
           + L RW+   G  + ++P LW+  LAA    P+   GV+            I G++ T  
Sbjct: 17  IRLLRWNKPEGRLILMIPALWAVFLAAAGKPPMPLVGVI------------ICGSMATSA 64

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICV 139
           A C  NDL D DID QV RTR RPL S   +    +V  ++    + V+    NP    +
Sbjct: 65  AGCVVNDLWDRDIDPQVERTRDRPLASRALSVKIGIVVGIVSLACAAVIAFYLNPLSFWL 124

Query: 140 GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVV 199
             A + + +LYP +KR    PQ+VL I +   V + W A+ A+ + P + L   T+ W +
Sbjct: 125 SVAAVPVIVLYPGAKRVFPVPQLVLSIAWGFAVLISWSAVTANITAPTWLLWGATVLWTL 184

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSY--QTKLWLFILYGIFVLCFMVAFCLLTVNFFA 257
            FDT+YA  D+ DD+ IG+NS+A  F     T + +F++  + +L  +  F  L   F  
Sbjct: 185 GFDTIYAMSDRIDDQRIGINSSAIFFGKYAPTAIAIFLMGTVILLAGVGFFVHLNTAF-- 242

Query: 258 WIGLLIALFLTIKRIIALDISCSKQCC--SFFHSAGVVGILILICLIISLF 306
           WI L++A    I +II L             F     +G LIL  +II  F
Sbjct: 243 WISLILATIAWIWQIIRLQQPEIPHPAYGEMFRQNVWIGFLILAGMIIGSF 293


>gi|221128039|ref|XP_002155224.1| PREDICTED: similar to para-hydroxybenzoate-polyprenyltransferase,
           mitochondrial [Hydra magnipapillata]
          Length = 279

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 85/267 (31%), Positives = 136/267 (50%), Gaps = 14/267 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L RW+   GW L + P L +  LAA      G  GW  I     ++ +G I+ R A 
Sbjct: 20  YLDLIRWNRPAGWLLLLWPTLSALWLAA-----GGFPGWHLIT----VFTLGTILMRSAG 70

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND+ D + D  V RT  RP+ SG+ +  +AL    +  L +F L+L  N   I   F
Sbjct: 71  CCVNDVADREFDKHVKRTAQRPVTSGRISSREALAVGAVLALAAFGLVLTTNAVTIASSF 130

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++L+YP++KR +  PQ VLG+ F+ G+ + + A+ A   W A+ L +G +FWV+ +
Sbjct: 131 AALAVALVYPYAKRHVSMPQAVLGVAFSFGIPMAYAAVRADVPWQAWALLVGNLFWVLAY 190

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAF--CLLTVNFFAWI 259
           DT YA  D+ DD  IG+ ++A        + +   YG+     +  +  C   V +    
Sbjct: 191 DTEYAMVDRDDDLRIGIKTSAITLGRWDVVAVLAFYGVRRPVGLPHYSGCRGPVAWGQAF 250

Query: 260 GLLIALFLTIKRIIA---LDISCSKQC 283
            LL      ++R+ A   L ++ +K+C
Sbjct: 251 HLLPGRHAALQRVSAVRHLGVALAKRC 277


>gi|300313090|ref|YP_003777182.1| 4-hydroxybenzoate octaprenyltransferase transmembrane protein
           [Herbaspirillum seropedicae SmR1]
 gi|300075875|gb|ADJ65274.1| 4-hydroxybenzoate octaprenyltransferase transmembrane protein
           [Herbaspirillum seropedicae SmR1]
          Length = 284

 Score =  130 bits (326), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 81/230 (35%), Positives = 117/230 (50%), Gaps = 16/230 (6%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R H   G    +L  LW T++A + L   GV  W      L IYIVG ++ R A 
Sbjct: 7   YALLVRAHKPIG----ILLLLWPTLIALW-LAAGGVPDWRI----LVIYIVGTVLMRSAG 57

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D + D  V RT  RPL SG+   ++AL+ A +  L+SF+L+L  N   + +  
Sbjct: 58  CAINDYADRNFDRHVKRTEQRPLTSGKIKSWEALMVAGVLALVSFLLILPLNALTLQLSV 117

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A + I+  YP+ KRF   PQ  LGI F  G+ +G+ ++  +    A+ L +  IFW V +
Sbjct: 118 AAVIIAGTYPYFKRFFAIPQAYLGIAFGFGIPMGFASVTGTVPLAAWVLLVANIFWAVAY 177

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLL 251
           DT YA  D+ DD  IG+ ++A  F               +LC+ VA  L+
Sbjct: 178 DTEYAMVDRDDDLKIGIKTSAITFGRYD-------VAAVMLCYAVALALI 220


>gi|170728817|ref|YP_001762843.1| 4-hydroxybenzoate octaprenyltransferase [Shewanella woodyi ATCC
           51908]
 gi|254790300|sp|B1KKU2|UBIA_SHEWM RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|169814164|gb|ACA88748.1| 4-hydroxybenzoate polyprenyl transferase [Shewanella woodyi ATCC
           51908]
          Length = 286

 Score =  130 bits (326), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 78/226 (34%), Positives = 121/226 (53%), Gaps = 9/226 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ LAR     G  L + PCL + VLAA         G       L I+I+G +V R   
Sbjct: 10  YLRLARMDRPIGTLLLMWPCLMALVLAA---------GGMPDLKVLVIFIIGVVVMRACG 60

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +DS V RT+SRPL SG+ +  +AL   V+  LI+F L+L  NP V+ + F
Sbjct: 61  CIINDYADRKLDSHVERTKSRPLASGEVSVKEALTLFVVMGLIAFGLVLMLNPLVVQLSF 120

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + ++++YPF+KRF   PQ+ LG+ ++  + + + A   +    A++L      W V +
Sbjct: 121 VGIILTIIYPFTKRFTNMPQMFLGVVWSWSIPMAYAAQTGTVPAEAWWLFAANWCWTVAY 180

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA 247
           DT+YA  D+ DD  +G+ STA LF    +  + +     + CF++A
Sbjct: 181 DTMYAMVDRDDDLKVGIKSTAILFGKYDRQVIALFQLAALACFIIA 226


>gi|326386681|ref|ZP_08208303.1| prenyltransferase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208996|gb|EGD59791.1| prenyltransferase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 328

 Score =  130 bits (326), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 139/287 (48%), Gaps = 14/287 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  LAR+    GW L   PC W   LA       G   W  + W L     G+IV RGA 
Sbjct: 51  YALLARFDRPIGWWLLFWPCAWGLFLAG------GTARWDILLWLLL----GSIVMRGAG 100

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C +ND+VD DID +V RT  RP+ SG  ++  A  +  +  +I  V+LL+          
Sbjct: 101 CVFNDIVDADIDVRVARTAVRPVASGAVSKKAAFAWIGVLCVIGLVVLLRLRWEAQLTAL 160

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW--PAFFLCIGTIFWVV 199
           A L +   YPF KR    PQ  LG+ F  G  VGW  + A FS   P   L  G   W +
Sbjct: 161 ASLALVAAYPFMKRITGWPQAWLGLVFTWGAPVGWVEV-AGFSRLAPLGLLYAGCWGWCM 219

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
            +DT+YA QD++DD L+G+ S+A  F    ++ +  LYG+ V+C+  AF L+  +  A +
Sbjct: 220 AYDTIYACQDREDDVLVGIGSSALSFGRHVRVGVAALYGMAVVCWAGAFWLVRPDPLALV 279

Query: 260 GLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI-LICLIISL 305
            LL        +++  D        + F +    G+L+   CL++ +
Sbjct: 280 ALLPVALHLGWQVVTFDPDDGAGSLARFRANRFAGLLMAAACLVVGV 326


>gi|319943166|ref|ZP_08017449.1| 4-hydroxybenzoate polyprenyl transferase [Lautropia mirabilis ATCC
           51599]
 gi|319743708|gb|EFV96112.1| 4-hydroxybenzoate polyprenyl transferase [Lautropia mirabilis ATCC
           51599]
          Length = 296

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 84/285 (29%), Positives = 137/285 (48%), Gaps = 9/285 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           YV L R H   G  L V P LW+  +A++        GW   +  LF + +G ++ R A 
Sbjct: 19  YVRLVRLHKPIGILLLVWPTLWALFVASH--------GWPPAY-PLFAFCLGTVLMRSAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D D D +V RT  RPL       ++A+   V+  L++  L+  F P V  +  
Sbjct: 70  CAINDFADRDFDGEVARTVDRPLARKAIAPWEAVAVFVVLSLLALPLVFPFGPLVWGLAV 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
               ++  YPF KRF   PQ  LGI F  G+ +G+ AL  +    A+ + +  IFW V +
Sbjct: 130 VAAVLAGSYPFFKRFFAIPQAYLGIAFGFGIPMGFAALTDTVPLSAWIMLLANIFWTVAY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IG+ ++A  F     L +   Y I +L  + AF    ++ + W+G+
Sbjct: 190 DTEYAMVDRDDDLKIGIRTSAITFGRHDVLAVMSCYAISLLLLVWAFAREGLSSWYWVGI 249

Query: 262 LIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
           ++A  + I     +     + C + F+     G  + + +++ +F
Sbjct: 250 VLAAGVAIYHYFLIRHRTREGCFAAFNHNNWFGAAVFLGVLLGVF 294


>gi|289677406|ref|ZP_06498296.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           syringae FF5]
          Length = 296

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 123/243 (50%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +A       G     T+F    I+++G  + R A 
Sbjct: 19  FIQLTRIDKPIGVYLLLWPTLWAVWIAG-----KGAPSLQTVF----IFVLGVFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +ALV   +   +SFVL+L  N   I + F
Sbjct: 70  CVINDFADRKVDGHVKRTEQRPLVSGKVSSREALVLFAVLVGLSFVLVLFTNAATIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAASYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGELPAAAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L G+ ++C M+A     +    +IGL
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILTLQGLALVCLMLAGARFELGACFYIGL 249

Query: 262 LIA 264
           L A
Sbjct: 250 LAA 252


>gi|331017830|gb|EGH97886.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 296

 Score =  129 bits (324), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 123/243 (50%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           +V L R     G +L + P LW+  +A       G    +T+F    I++ G  + R A 
Sbjct: 19  FVQLTRIDKPIGIYLLLWPTLWAVWIAG-----KGSPSLNTVF----IFVAGVFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +ALV   +   +SFVL+L  N   I + F
Sbjct: 70  CVINDFADRKVDGHVKRTEQRPLVSGKVSSREALVLFAVLVSLSFVLVLFTNSTTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAACYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGELPAAAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L G+ + C  +A     +  F ++GL
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILSLQGLALGCLALAGSRFELGAFFYMGL 249

Query: 262 LIA 264
           L+A
Sbjct: 250 LVA 252


>gi|28899722|ref|NP_799327.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|153839844|ref|ZP_01992511.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio parahaemolyticus
           AQ3810]
 gi|260361673|ref|ZP_05774700.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio parahaemolyticus
           K5030]
 gi|260879365|ref|ZP_05891720.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio parahaemolyticus
           AN-5034]
 gi|260897192|ref|ZP_05905688.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio parahaemolyticus
           Peru-466]
 gi|260899145|ref|ZP_05907540.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio parahaemolyticus
           AQ4037]
 gi|81726688|sp|Q87KM9|UBIA_VIBPA RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|28807974|dbj|BAC61211.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|149746639|gb|EDM57627.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio parahaemolyticus
           AQ3810]
 gi|308089322|gb|EFO39017.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio parahaemolyticus
           Peru-466]
 gi|308092837|gb|EFO42532.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio parahaemolyticus
           AN-5034]
 gi|308107495|gb|EFO45035.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio parahaemolyticus
           AQ4037]
 gi|308111292|gb|EFO48832.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio parahaemolyticus
           K5030]
 gi|328472451|gb|EGF43317.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio parahaemolyticus
           10329]
          Length = 284

 Score =  129 bits (324), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 87/286 (30%), Positives = 143/286 (50%), Gaps = 15/286 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P +W+ V+AA      G+  W      L ++++G  + R A 
Sbjct: 9   YWQLMRMDRPIGSLLLLWPTVWALVIAA-----QGIPSWDV----LIVFVLGVFLMRSAG 59

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT+ RPLPSG+ T  +A+   ++  + SF+L+L  NP  I + F
Sbjct: 60  CVINDFADRKVDGHVKRTKQRPLPSGKVTAKEAIGLFLVLAVSSFLLVLTMNPLTIQLSF 119

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++ +YPF KR+   PQ+ LG+ F+  + + W A         +F+ +    W + +
Sbjct: 120 AGLVLAFIYPFMKRYTHIPQLFLGLAFSWAIPMAWAAQTGELPVMVWFVFVINALWTIAY 179

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA---FCLLTVNFFAW 258
           DT YA  D+ DD  IG+ STA LF    KL + +L  +  L  +V    F  L  +++  
Sbjct: 180 DTQYAMVDRDDDLKIGIKSTAILFGRHDKLIIGVLQ-LVTLAMLVGLGQFYQLGQSYYWT 238

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           + +  +LF+  + +I         C   F +   VG++I I L+++
Sbjct: 239 VLIAASLFVYQQHLIRH--RERDLCFRAFLNNNYVGMVIAIGLLVA 282


>gi|28872581|ref|NP_795200.1| 4-hydroxybenzoate polyprenyl transferase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213968547|ref|ZP_03396690.1| 4-hydroxybenzoate polyprenyl transferase [Pseudomonas syringae pv.
           tomato T1]
 gi|301383519|ref|ZP_07231937.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           tomato Max13]
 gi|302062569|ref|ZP_07254110.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           tomato K40]
 gi|302130236|ref|ZP_07256226.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|81728952|sp|Q87U39|UBIA_PSESM RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|28855836|gb|AAO58895.1| 4-hydroxybenzoate polyprenyl transferase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213926835|gb|EEB60387.1| 4-hydroxybenzoate polyprenyl transferase [Pseudomonas syringae pv.
           tomato T1]
          Length = 296

 Score =  129 bits (324), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 123/243 (50%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           +V L R     G +L + P LW+  +A       G    +T+F    I++ G  + R A 
Sbjct: 19  FVQLTRIDKPIGIYLLLWPTLWAVWIAG-----KGSPSLNTVF----IFVAGVFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +ALV   +   +SFVL+L  N   I + F
Sbjct: 70  CVINDFADRKVDGHVKRTEQRPLVSGKVSSREALVLFAVLVSLSFVLVLFTNSTTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAACYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGELPAAAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L G+ + C  +A     +  F ++GL
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILSLQGLALGCLALAGSRFELGAFFYMGL 249

Query: 262 LIA 264
           L+A
Sbjct: 250 LVA 252


>gi|156044602|ref|XP_001588857.1| hypothetical protein SS1G_10405 [Sclerotinia sclerotiorum 1980]
 gi|154694793|gb|EDN94531.1| hypothetical protein SS1G_10405 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 1005

 Score =  129 bits (324), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 85/224 (37%), Positives = 116/224 (51%), Gaps = 16/224 (7%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S   PY  L R     G +    PCL+ST+LAA PL    ++   T+     ++  GA++
Sbjct: 106 SPWVPYAELIRLDKPAGTYYLFFPCLFSTLLAA-PLT-VPMVSPLTVVGTSLLFFSGALI 163

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT NDL D ++D  V RTR RP+  G  + F+ALVF   Q      +LLQF P+ 
Sbjct: 164 MRGAGCTINDLWDRNLDPNVTRTRLRPIARGAVSPFKALVFTGGQLFAGLAILLQF-PYQ 222

Query: 137 ICVGFA---LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL-------HASFSWP 186
            C  +A   LLF++  YP +KR    PQ VLG+ F+ G  +G+ AL        A+ +  
Sbjct: 223 -CFFYATPSLLFVA-AYPLAKRVTHYPQFVLGLTFSWGAIMGFPALGIDLLSDSAALTAT 280

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
             FL    + W V +D +YAH D KDD   G+ S A     QTK
Sbjct: 281 G-FLYASNVAWTVLYDMIYAHMDIKDDAKAGIKSIALRHDAQTK 323


>gi|134302246|ref|YP_001122215.1| 4-hydroxybenzoate polyprenyltransferase [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|156501744|ref|YP_001427809.1| 4-hydroxybenzoate polyprenyltransferase [Francisella tularensis
           subsp. holarctica FTNF002-00]
 gi|290954428|ref|ZP_06559049.1| 4-hydroxybenzoate polyprenyltransferase [Francisella tularensis
           subsp. holarctica URFT1]
 gi|295312129|ref|ZP_06802938.1| 4-hydroxybenzoate polyprenyltransferase [Francisella tularensis
           subsp. holarctica URFT1]
 gi|167011547|sp|A7NA50|UBIA_FRATF RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|167011549|sp|A4IYU3|UBIA_FRATW RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|134050023|gb|ABO47094.1| 4-hydroxybenzoate polyprenyl transferase [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|156252347|gb|ABU60853.1| 4-hydroxybenzoate polyprenyl transferase [Francisella tularensis
           subsp. holarctica FTNF002-00]
          Length = 289

 Score =  129 bits (323), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 85/294 (28%), Positives = 144/294 (48%), Gaps = 9/294 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
             +  Y  L R H      L + P L + VLA++ L             YL I+ +G +V
Sbjct: 4   QQLKAYFMLMRLHRPIPILLILWPTLTALVLASHGLPDIS---------YLVIFTIGVVV 54

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R   C  ND+ D D D  V RT +RPL SGQ +   A+   +   L++F+ +L  N + 
Sbjct: 55  MRTVGCIINDIADVDFDKHVARTNTRPLTSGQLSIKNAIWLCISLTLVAFICVLFLNLYT 114

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I + F  LF+++LYPF KRF   PQ++LG+ F  G+F+ + A+       A+   I TI 
Sbjct: 115 ILLSFVALFLAILYPFCKRFFAIPQLILGLAFNFGIFMAFSAIQNQIPVEAWIFYIATIC 174

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
           W + +DT+YA  D++ D  IG+ S+A LF  +   ++ +   + +L  ++       N F
Sbjct: 175 WTIAYDTIYALADREFDLEIGIKSSAVLFGNKVFRYILLFNFLSLLLLIILGIYCDFNSF 234

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
            ++G++I     ++            C + F +   +G++I I  +I   + +F
Sbjct: 235 FYLGVVICSLFFVRNYFLYKKLGITNCINAFSANHWIGLIIFIIAVIQYIIKEF 288


>gi|289628102|ref|ZP_06461056.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289651290|ref|ZP_06482633.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330870967|gb|EGH05676.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 296

 Score =  129 bits (323), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 85/243 (34%), Positives = 122/243 (50%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +A       G     T+F    I++VG  + R A 
Sbjct: 19  FIQLTRIDKPIGIYLLLWPTLWAVWIAG-----KGSPSLKTVF----IFVVGVFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +ALV   +   +SFVL+L  N   I + F
Sbjct: 70  CVINDFADRKVDGHVKRTEQRPLVSGKVSSREALVLFAVLVGLSFVLVLFTNATTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAACYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGDLPAAAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L G+ + C M+A     +    +IGL
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILTLQGLALGCLMLAGARFELGACFYIGL 249

Query: 262 LIA 264
           L A
Sbjct: 250 LAA 252


>gi|127514312|ref|YP_001095509.1| 4-hydroxybenzoate octaprenyltransferase [Shewanella loihica PV-4]
 gi|167011558|sp|A3QIF2|UBIA_SHELP RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|126639607|gb|ABO25250.1| 4-hydroxybenzoate octaprenyltransferase [Shewanella loihica PV-4]
          Length = 286

 Score =  129 bits (323), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 113/205 (55%), Gaps = 9/205 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ LAR     G  L + PCL + VLAA         G       L I+++G +V R   
Sbjct: 10  YLRLARMDRPIGTFLLLWPCLMALVLAA---------GGMPDLKVLIIFVIGVVVMRACG 60

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +DS V RT+SRPL SG+ T  +AL+  V+  L++F L+L  NP V+ + F
Sbjct: 61  CIINDYADRKLDSHVERTKSRPLASGEVTVKEALILFVVMGLLAFGLVLMLNPLVVQLSF 120

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + ++++YPF+KRF   PQ+ LG+ ++  + + + A   +    A++L      W V +
Sbjct: 121 VGIILTIIYPFTKRFTNMPQMFLGVVWSWSIPMAYAAQLGTVPVEAWWLFAANWCWTVAY 180

Query: 202 DTVYAHQDKKDDELIGVNSTARLFS 226
           DT+YA  D+ DD  +G+ STA LF 
Sbjct: 181 DTMYAMVDRDDDLKVGIKSTAILFG 205


>gi|153209094|ref|ZP_01947237.1| 4-hydroxybenzoate polyprenyl transferase [Coxiella burnetii 'MSU
           Goat Q177']
 gi|212219461|ref|YP_002306248.1| 4-hydroxybenzoate polyprenyltransferase [Coxiella burnetii
           CbuK_Q154]
 gi|254790263|sp|B6J612|UBIA_COXB1 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|120575503|gb|EAX32127.1| 4-hydroxybenzoate polyprenyl transferase [Coxiella burnetii 'MSU
           Goat Q177']
 gi|212013723|gb|ACJ21103.1| 4-hydroxybenzoate polyprenyltransferase [Coxiella burnetii
           CbuK_Q154]
          Length = 287

 Score =  129 bits (323), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 91/289 (31%), Positives = 145/289 (50%), Gaps = 11/289 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
             I  Y+ L R+    G  L + P LW+  +AA           +  F    I+I G++V
Sbjct: 6   QQIPHYLRLMRFDKPVGIFLLLWPTLWAVWIAAKG---------APSFKIAVIFIAGSVV 56

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLISFVLLLQFNPF 135
            R A C  ND  D  +D  V RT+ RPL SG  +  +A L+FAVL  LI+F L+L  N  
Sbjct: 57  MRAAGCIVNDFADRHLDKHVQRTQMRPLASGSVSVTEAMLLFAVLS-LIAFTLVLLLNRL 115

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTI 195
            + +    + ++L+YPF KRF   PQ+ LGI F+  + + + A        A+ L    +
Sbjct: 116 TVELAVIGILLALVYPFLKRFTHLPQLWLGIAFSWSIPMAFAATVGHVPAVAWLLFFAAV 175

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT YA  D++DD  +G+ STA LF    +L + +L G  +L F +    L  N+
Sbjct: 176 LWPIVYDTQYAMIDREDDVKVGIKSTAILFGRYDRLMIGLLQGSVLLTFGLLGWYLRFNY 235

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           + ++GLL+AL L   +   +       C + F +   VG  I + ++++
Sbjct: 236 WFYLGLLVALGLMCYQQFLIRHRKPPDCFAAFRNNNWVGFFIFLGILLT 284


>gi|33152679|ref|NP_874032.1| 4-hydroxybenzoate octaprenyltransferase [Haemophilus ducreyi
           35000HP]
 gi|81423273|sp|Q7VL38|UBIA_HAEDU RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|33148903|gb|AAP96421.1| 4-hydroxybenzoate octaprenyltransferase [Haemophilus ducreyi
           35000HP]
          Length = 277

 Score =  128 bits (322), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 84/224 (37%), Positives = 117/224 (52%), Gaps = 19/224 (8%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           L R+    G  L + P LW+   AA      G +  S+I   L I+I+G IV R A C  
Sbjct: 3   LMRFDKPIGTLLLLHPTLWALFAAA------GGIPSSSI---LIIFILGVIVMRAAGCVI 53

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND  D  ID +V RT  RPL +G+ T  +A V   +  +I+F+L L  N +   + F  +
Sbjct: 54  NDYADRHIDGKVKRTSQRPLATGRVTTVEAKVLFFVLLIIAFLLDLSLNQYAFLLSFVAV 113

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            ++++YPF KRF   PQVVLG+ F   + + +GA+        + L +  I W V +DT 
Sbjct: 114 ALAVIYPFMKRFTHLPQVVLGMAFGWAIPMAYGAVIEDLPLTCWLLFLANILWTVAYDTQ 173

Query: 205 YAHQDKKDDELIGVNSTARLFS-YQTK---------LWLFILYG 238
           YA  D+ DD  IGV STA LF+ Y  K         L LFIL+G
Sbjct: 174 YAMVDRDDDLRIGVKSTAILFAQYDNKIIALLQFLSLILFILFG 217


>gi|91227493|ref|ZP_01261830.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio alginolyticus
           12G01]
 gi|269968653|ref|ZP_06182650.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio alginolyticus 40B]
 gi|91188517|gb|EAS74809.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio alginolyticus
           12G01]
 gi|269826740|gb|EEZ81077.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio alginolyticus 40B]
          Length = 284

 Score =  128 bits (322), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 87/285 (30%), Positives = 144/285 (50%), Gaps = 13/285 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P +W+ +++A      G+  W        ++++G  + R A 
Sbjct: 9   YWQLMRMDRPIGSLLLMWPTIWALIISA-----QGMPSWDV----FIVFVLGVFLMRSAG 59

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT+ RPLPSG+ T  +A+   ++  + SF+L+L  NP  I + F
Sbjct: 60  CVINDFADRKVDGHVKRTKQRPLPSGKVTAKEAIGLFLVLGISSFLLVLTMNPLTIQLSF 119

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A + ++ +YPF KR+   PQ+ LG+ F+  + + W A         +FL +    W + +
Sbjct: 120 AGIVLAFIYPFMKRYTHIPQLFLGLAFSWAIPMAWAAQTGELPLIVWFLFLINALWTIAY 179

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIF--VLCFMVAFCLLTVNFFAWI 259
           DT YA  D+ DD  IG+ STA LF    KL + +L  I   +L ++  F  L  +++ W 
Sbjct: 180 DTQYAMVDRDDDLKIGIKSTAILFGRHDKLIIGVLQLITLAMLVWLGQFYQLGQSYY-WT 238

Query: 260 GLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            LLIA  L + +   +     + C   F +   VG++I I L+++
Sbjct: 239 -LLIAASLFVYQQHLIRHRERELCFKAFLNNNYVGMVIAIGLLVA 282


>gi|330813639|ref|YP_004357878.1| 4-hydroxybenzoate polyprenyltransferase [Candidatus Pelagibacter
           sp. IMCC9063]
 gi|327486734|gb|AEA81139.1| 4-hydroxybenzoate polyprenyltransferase [Candidatus Pelagibacter
           sp. IMCC9063]
          Length = 285

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 84/290 (28%), Positives = 138/290 (47%), Gaps = 5/290 (1%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           +  Y  L R     G  L   PC W  V+A   +    +      + YL ++  G+++ R
Sbjct: 1   MRKYFKLIRLDKPAGIFLLFWPCAWGLVIANSSINNDILF-----YKYLILFFFGSVLMR 55

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
            A C +ND++D  ID +V RT +RP+  G  +  QA     L   +S ++L QFN   I 
Sbjct: 56  SAGCVYNDIIDRKIDQKVKRTSARPVAIGSVSVSQAWSVIFLLIFLSLIILFQFNLNSII 115

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
            G +   +  +YPF KR    PQ+ LGI F  GV + W A    FS+    L I  I W 
Sbjct: 116 FGLSSGILVAIYPFMKRITYWPQLFLGITFNWGVILAWLAFEGEFSFAPVLLYISAILWT 175

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+Y  QD KDD  IG+ ST+  F  + K +L   Y   +   +V+  +L  N + +
Sbjct: 176 LGYDTIYGMQDIKDDLKIGIKSTSIKFEKKIKFFLLFCYLTSISFLLVSLKVLNTNIYTY 235

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLD 308
           I  +++  +   +I+  +    ++    F      G+ I + L++++  D
Sbjct: 236 ILAILSSGILFFQILVYEKDKPEKNFKLFALNNYYGLSIFLTLMVTINND 285


>gi|269103886|ref|ZP_06156583.1| 4-hydroxybenzoate polyprenyltransferase [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268163784|gb|EEZ42280.1| 4-hydroxybenzoate polyprenyltransferase [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 287

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 92/288 (31%), Positives = 141/288 (48%), Gaps = 11/288 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  LAR+    G  L + P LW+  LAA         GW +    L ++++G I  R A 
Sbjct: 10  YWQLARFDRPIGSLLLLWPTLWALFLAAD--------GWPSPH-VLVVFVLGVIFMRAAG 60

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D + D  V RT  RP+PSG+ +  +AL    L  LISF+L+L  N   I +  
Sbjct: 61  CVINDFADRNFDGHVKRTCQRPMPSGKVSEREALGLFGLLVLISFLLVLTMNTLTISLSV 120

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQ+VLG+ F   + + + A        A+ L    I W + +
Sbjct: 121 IGLALAAAYPFMKRYTHLPQLVLGVAFGWSIPMAYAAQSGQLPLAAWLLFAANILWTIAY 180

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN-FFAWIG 260
           DT YA  D+ DD  IG+ STA LF    K+ + +L    +L       +L ++  F W  
Sbjct: 181 DTQYAMVDRDDDLKIGIKSTAILFGRFDKMIIGMLQLGTLLLLTAVGGVLGLSQIFYWFL 240

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLD 308
           LL A+    ++++ +     + C   F +   VG++I I L +S+ L+
Sbjct: 241 LLAAMLFVYQQML-IKQRQREDCFRAFLNNNYVGMVICIGLAVSVLLN 287


>gi|326797357|ref|YP_004315177.1| 4-hydroxybenzoate octaprenyltransferase [Marinomonas mediterranea
           MMB-1]
 gi|326548121|gb|ADZ93341.1| 4-hydroxybenzoate octaprenyltransferase [Marinomonas mediterranea
           MMB-1]
          Length = 284

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 93/290 (32%), Positives = 143/290 (49%), Gaps = 12/290 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL-FIYIVGAI 75
           S ++ Y  L R++   G  L + P LW+  LAA         GW    W+L  I+++G  
Sbjct: 2   SKLSDYADLTRFNRPIGSFLLMWPTLWALWLAAN--------GWPE--WHLILIFVLGVF 51

Query: 76  VTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPF 135
             R A C  ND  D  +D  V RT++RPLPSG+    +AL+   +  ++SF+L+L  +  
Sbjct: 52  SMRSAGCVINDYADRKVDGHVERTKNRPLPSGRVGEKEALLLFAVLAVLSFILVLFTDLQ 111

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHAS-FSWPAFFLCIGT 194
            I + F  LF++ LYPF KR+   PQV LG+ F+  + + + A   S F    + L +  
Sbjct: 112 TIALSFVGLFLAALYPFMKRYTHLPQVFLGLAFSWAIPMAYSAQGGSLFDVQLWMLFVAN 171

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
           +FW V +DT YA  D+ DD  IGV STA LF       + +L G+ +           +N
Sbjct: 172 VFWTVAYDTYYAITDRPDDLKIGVKSTAILFGQYDLFVILVLQGLTLSLLTWIGITSHLN 231

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           +  +IGL + +F   K+         + C   F     VG  + I L++S
Sbjct: 232 WPYFIGLAVCVFWFFKQYKQGQHRDRQACFRSFLDNNRVGYTVFIGLVLS 281


>gi|118594140|ref|ZP_01551487.1| putative 4-hydroxybenzoate octaprenyltransferase [Methylophilales
           bacterium HTCC2181]
 gi|118439918|gb|EAV46545.1| putative 4-hydroxybenzoate octaprenyltransferase [Methylophilales
           bacterium HTCC2181]
          Length = 286

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 84/280 (30%), Positives = 149/280 (53%), Gaps = 13/280 (4%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           LAR +   G    +L  LW T+ A +    +G L  + +   + I+I+G+++ R A C  
Sbjct: 14  LARLNKPIG----ILLLLWPTLTALW--FSSGQLPETKL---IAIFILGSVLMRSAGCIA 64

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND+ D +ID++V RT+SRPL   +     AL F ++  +ISFVL+LQ N + I +    L
Sbjct: 65  NDMADRNIDAKVQRTKSRPLAQEKIRLKSALAFLLIHLIISFVLVLQLNTYAIFLSAMAL 124

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
             +L+YPF KRF+  PQ  LG+ F  G+ + + A   S     + L  G + WV+ +D+ 
Sbjct: 125 IFALIYPFCKRFVKVPQFFLGVAFGFGILMAFAATQNSIPVEGWLLFAGNLLWVMGYDSH 184

Query: 205 YAHQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFMVAFC-LLTVNFFAWIGLL 262
           YA  D +DD+ + + S+A+    +T +++ I +  ++++ F +      +  F++ I  L
Sbjct: 185 YALMDVEDDKKLAIYSSAKTLGRRTTIFITINFIAMYIIYFYIGLQEEYSYGFYSLI--L 242

Query: 263 IALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
           +A F++I  I+    +  K     F +   VG+ I +  +
Sbjct: 243 LAAFISIYTIVIGGDNRHKNNYKAFVANNYVGLFIFLAFV 282


>gi|330976280|gb|EGH76341.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 296

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 122/243 (50%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +A       G     T+F    I+++G  + R A 
Sbjct: 19  FIQLTRIDKPIGVYLLLWPTLWAVWIAG-----KGAPSLQTVF----IFVLGVFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +ALV   +   +SFVL+L  N   I + F
Sbjct: 70  CVINDFADRKVDGHVKRTEQRPLVSGKVSSREALVLFAVLVGLSFVLVLFTNAATIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAASYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGELPAAAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L G+ + C M+A     +    +IGL
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILTLQGLALGCLMLAGARFELGACFYIGL 249

Query: 262 LIA 264
           L A
Sbjct: 250 LAA 252


>gi|312884408|ref|ZP_07744113.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367930|gb|EFP95477.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 284

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 142/285 (49%), Gaps = 13/285 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L R     G  L + P +WS ++AA  +    VL          ++ +G +  R A 
Sbjct: 9   YLQLMRMDKPIGTLLLLWPTMWSLIIAAEGMPDYHVL---------VVFTLGVVFMRAAG 59

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT+ RP+P+G+ +  +A++   L    SF+L+L  N   I + F
Sbjct: 60  CVINDYADRKVDGYVKRTKHRPMPTGRVSPKEAIILFCLLAFASFLLVLSMNTLTIQLSF 119

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + ++ +YPF KRF   PQ+ LG  ++  + + W A     +  A ++ +  + W + +
Sbjct: 120 VGVLLAFIYPFMKRFTHLPQLFLGFAYSWSIPMAWAAQTNELTVMAGYIFLINLLWTIAY 179

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFI--LYGIFVLCFMVAFCLLTVNFFAWI 259
           DT YA  D+ DD  IG+ STA LF    K  + I  L+ + +L  +     L + ++A++
Sbjct: 180 DTQYAMVDRDDDLKIGIKSTAILFGRYDKFVIGILQLFTLIMLIVLGKLYSLGLTYYAFL 239

Query: 260 GLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
              ++LF+  + I  +      QC   F +   VG+LI + L+IS
Sbjct: 240 AAALSLFVFQQFI--MRNRDRHQCFRAFLNNNYVGMLITLGLLIS 282


>gi|51473866|ref|YP_067623.1| prenyltransferase [Rickettsia typhi str. Wilmington]
 gi|51460178|gb|AAU04141.1| 4-hydroxybenzoate octaprenyltransferase [Rickettsia typhi str.
           Wilmington]
          Length = 282

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 134/276 (48%), Gaps = 10/276 (3%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           L R      + L   P L+  +LA         + +S   + L ++I G+I  R + C  
Sbjct: 13  LMRADKPVAYLLVFFPALFGLLLA-----NPANMEFS---YLLPLFICGSITARSSGCII 64

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND+ D   D  V RT+ RPL SG  +   A+    +  ++S  +LL  N   I  GF  +
Sbjct: 65  NDIFDRKFDKYVARTKKRPLASGTVSVSYAIFILSILSILSLCILLLLNKTAIYTGFFAV 124

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            + +LYP  KR I  PQ+ LG  F  GV V +GA+       A  + +   FW + +DT+
Sbjct: 125 IMIILYPLMKRIIYFPQIFLGFTFKLGVLVAYGAVQDKLDMAAIIMYLACCFWAIGYDTI 184

Query: 205 YAHQDKKDDELIGVNS-TARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLI 263
           Y + D KDD+ IGV S +  L     K WL+I Y  F+L F++A  +   N   ++ + +
Sbjct: 185 YGYMDIKDDKKIGVKSLSIYLEDKNPKFWLYICYIGFILLFIIAAKIANFN-IDYLPVAV 243

Query: 264 ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILI 299
           AL L   ++  LDI     C   F +   VG+L+++
Sbjct: 244 ALILLTLQVATLDIKNPVNCIKRFSANNYVGVLLIM 279


>gi|18389308|dbj|BAB84123.1| PGT-2 [Lithospermum erythrorhizon]
          Length = 306

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 99/305 (32%), Positives = 137/305 (44%), Gaps = 32/305 (10%)

Query: 12  DCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAA----YPLRRAGVLGWSTIFWYL 67
           +  +   + PY +LAR     G  L   P  WS  L A     P +   + GW    W +
Sbjct: 18  EIYLPKEVRPYAHLARLDKPIGSWLLAWPAFWSVALIADLGSLP-KMLAIFGW----WAV 72

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
           +I        RGA CT ND  D D D +V RT+SRPL SG  +  + L +   Q  I   
Sbjct: 73  WI--------RGAGCTINDYFDRDFDKKVERTKSRPLASGAVSPAKGLWWLAFQLFIGLG 124

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP- 186
           +L QFN   + +    +     YP  KR    PQ  LG+  + G  +G  AL  S   P 
Sbjct: 125 VLYQFNILTLALAIVHVPFVFAYPLMKRITYWPQAFLGVMISWGALLGSSALKGSVV-PS 183

Query: 187 -AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFM 245
            A+ L I + FW + +DT+YAHQDK DD   G+ STA  F   TK+W+   +GI  +   
Sbjct: 184 IAYPLYISSFFWTLVYDTIYAHQDKVDDAKAGIKSTALRFGDATKIWI-TWFGIGCIG-- 240

Query: 246 VAFCLLTVNFFAWIGLLIALFLTIK------RIIALDISCSKQCCSFFHSAGVVGILILI 299
               LL   F   IGL   +FL I       +I  +D+S    C   F S    G +I  
Sbjct: 241 ---ALLLGGFIVNIGLPYYVFLAIATGQLIWQIFTVDLSSPMDCGKKFVSNQWFGAIIFT 297

Query: 300 CLIIS 304
            +++ 
Sbjct: 298 GILVG 302


>gi|229587044|ref|YP_002845545.1| 4-hydroxybenzoate polyprenyltransferase [Rickettsia africae ESF-5]
 gi|228022094|gb|ACP53802.1| 4-hydroxybenzoate octaprenyltransferase [Rickettsia africae ESF-5]
          Length = 282

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 83/272 (30%), Positives = 137/272 (50%), Gaps = 10/272 (3%)

Query: 27  RWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWND 86
           R      + L   P L+  +LA  P R       + +   L ++I+G+I  R + C  ND
Sbjct: 15  RADKLVAYLLVFFPALFGLLLAN-PSR-------TELIHLLPLFILGSITARSSGCIIND 66

Query: 87  LVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFI 146
           + D   D  V RT+ RPL S   +   A++   +  +IS  +LL  N   IC+GF  + +
Sbjct: 67  IFDRKFDKHVARTKERPLASKALSVSYAILILFILSVISLCILLLLNKTAICIGFFAVIM 126

Query: 147 SLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYA 206
            +LYP  KR    PQ+ LG  F  GV + + A+  +    A  + +   FW + +DT+Y 
Sbjct: 127 IILYPLMKRITYFPQIFLGFTFKLGVLIAYAAVQDTLDIAAIIMYLACCFWAIGYDTIYG 186

Query: 207 HQDKKDDELIGVNS-TARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIAL 265
           + D +DD+ IGV S +  L +  +KLWL+I Y  F+L F++A  +   N   ++ +L  L
Sbjct: 187 YMDIRDDKKIGVKSLSIYLENKHSKLWLYICYIGFILLFILATKMANHN-IDYLPILAVL 245

Query: 266 FLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
            L I ++  LDI     C + F +   +G+++
Sbjct: 246 ILLILQVATLDIENPANCMTRFKANNYIGLVL 277


>gi|162149022|ref|YP_001603483.1| putative 4-hydroxybenzoate polyprenyl transferase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787599|emb|CAP57195.1| putative 4-hydroxybenzoate polyprenyl transferase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 336

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 141/287 (49%), Gaps = 11/287 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LAR     G  L  LP +W  +LA+      GV    T    + ++ +G++V R A
Sbjct: 56  PYALLARLDRPIGTWLLFLPGMWGILLAS------GVDA-RTRLRLIVLFGIGSVVMRSA 108

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C  ND+ D DID  V RT  RPL SG     QA +F     +I  V+LLQ NP    +G
Sbjct: 109 GCVVNDMWDRDIDRLVARTAGRPLASGALRMRQAALFLAGLLVIGLVILLQLNPLARVLG 168

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL--HASFSWPAFFLCIGTIFWV 198
            + L +  LYP +KRF   PQ+V+G  F  G  +G+ A       +W A +    TI W 
Sbjct: 169 ASSLILVGLYPLAKRFTWWPQLVMGFTFGFGAPLGYAAATGRVDAAWGALYAA--TILWQ 226

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + FDT+Y  QD +DD  IGV ST+RL++ Q +L++   Y + V   ++A  L       W
Sbjct: 227 LGFDTIYGFQDMEDDARIGVKSTSRLWAGQPRLFVGACYALAVAALLLAGWLAGCGAGFW 286

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
           I + +       ++  LD +   +C S F      G+ I + ++  L
Sbjct: 287 IAMALPTIALAWQVAQLDSTDPARCLSLFRFNRETGLAIALAILAGL 333


>gi|90023477|ref|YP_529304.1| 4-hydroxybenzoate octaprenyltransferase [Saccharophagus degradans
           2-40]
 gi|118574222|sp|Q21DY7|UBIA_SACD2 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|89953077|gb|ABD83092.1| 4-hydroxybenzoate octaprenyltransferase [Saccharophagus degradans
           2-40]
          Length = 299

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 111/217 (51%), Gaps = 9/217 (4%)

Query: 15  MGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGA 74
           + + +  Y  L R     G +L + P LWS  +AA      G+  W      L I+++G 
Sbjct: 14  LKATLVAYAKLMRLDRPIGIYLVLWPTLWSLWIAA-----DGLPDWDV----LVIFVLGV 64

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
           ++ R A C  ND  D  ID  V RT +RPL +G  T  QA++F V   +I+F+L+L  NP
Sbjct: 65  VLMRSAGCVINDFADRKIDGHVRRTANRPLVTGLITPKQAVLFFVALLVIAFILVLFTNP 124

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT 194
             I + F    ++  YPF KR+   PQ+VLG  FA  + + + A         + L    
Sbjct: 125 LTIKLSFGGALLAFCYPFMKRYTQLPQIVLGAAFAWSIPMAFAAQTNQLPEAIWVLYTAV 184

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
           + W V +DT YA  D++DD  IGV STA LF  Q ++
Sbjct: 185 VLWTVAYDTFYAMADREDDLKIGVKSTAILFGDQDRI 221


>gi|330890624|gb|EGH23285.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           mori str. 301020]
          Length = 296

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 121/243 (49%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +A       G     T+F    I++VG  + R A 
Sbjct: 19  FIQLTRIDKPIGIYLLLWPTLWAVWIAG-----KGSPSLKTVF----IFVVGVFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +AL    +   +SFVL+L  N   I + F
Sbjct: 70  CVINDFADRKVDGHVKRTEQRPLVSGKVSSREALALFAVLVGLSFVLVLFTNATTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAACYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGDLPAAAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L G+ + C M+A     +    +IGL
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILTLQGLALGCLMLAGARFELGACFYIGL 249

Query: 262 LIA 264
           L A
Sbjct: 250 LAA 252


>gi|328676455|gb|AEB27325.1| 4-hydroxybenzoate polyprenyltransferase [Francisella cf. novicida
           Fx1]
          Length = 284

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 111/212 (52%), Gaps = 9/212 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
             +  Y  L R H      L + P L + VLA++ L             YL I+ +G +V
Sbjct: 4   QQLKAYFMLMRLHRPIPILLILWPTLTALVLASHGLPDIS---------YLVIFTIGVVV 54

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R   C  ND+ D D D  V RT +RPL SGQ +   A+   +   L++F+ +L  N + 
Sbjct: 55  MRTVGCIINDIADIDFDKHVARTNTRPLTSGQLSIKNAIRLCISLTLVAFICVLFLNLYT 114

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I + F  LF+++LYPF KRF   PQ++LG+ F  G+F+ + A+       A+   + TI 
Sbjct: 115 ILLSFVALFLAILYPFCKRFFAIPQLILGLAFNFGIFMAFSAIQNQIPVEAWIFYLATIC 174

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQ 228
           W + +DT+YA  D++ D  IG+ S+A LF  +
Sbjct: 175 WTIAYDTIYALADREFDLEIGIKSSAVLFGNK 206


>gi|89255776|ref|YP_513138.1| 4-hydroxybenzoate polyprenyltransferase [Francisella tularensis
           subsp. holarctica LVS]
 gi|167009696|ref|ZP_02274627.1| prenyltransferase [Francisella tularensis subsp. holarctica FSC200]
 gi|187931267|ref|YP_001891251.1| 4-hydroxybenzoate polyprenyltransferase [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|254367137|ref|ZP_04983169.1| 4-hydroxybenzoate octaprenyltransferase [Francisella tularensis
           subsp. holarctica 257]
 gi|118574203|sp|Q2A564|UBIA_FRATH RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790278|sp|B2SF41|UBIA_FRATM RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|89143607|emb|CAJ78795.1| 4-hydroxybenzoate octaprenyltransferase [Francisella tularensis
           subsp. holarctica LVS]
 gi|134252959|gb|EBA52053.1| 4-hydroxybenzoate octaprenyltransferase [Francisella tularensis
           subsp. holarctica 257]
 gi|187712176|gb|ACD30473.1| 4-hydroxybenzoate polyprenyl transferase [Francisella tularensis
           subsp. mediasiatica FSC147]
          Length = 284

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 111/212 (52%), Gaps = 9/212 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
             +  Y  L R H      L + P L + VLA++ L             YL I+ +G +V
Sbjct: 4   QQLKAYFMLMRLHRPIPILLILWPTLTALVLASHGLPDIS---------YLVIFTIGVVV 54

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R   C  ND+ D D D  V RT +RPL SGQ +   A+   +   L++F+ +L  N + 
Sbjct: 55  MRTVGCIINDIADVDFDKHVARTNTRPLTSGQLSIKNAIWLCISLTLVAFICVLFLNLYT 114

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I + F  LF+++LYPF KRF   PQ++LG+ F  G+F+ + A+       A+   I TI 
Sbjct: 115 ILLSFVALFLAILYPFCKRFFAIPQLILGLAFNFGIFMAFSAIQNQIPVEAWIFYIATIC 174

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQ 228
           W + +DT+YA  D++ D  IG+ S+A LF  +
Sbjct: 175 WTIAYDTIYALADREFDLEIGIKSSAVLFGNK 206


>gi|161831365|ref|YP_001596029.1| 4-hydroxybenzoate polyprenyl transferase [Coxiella burnetii RSA
           331]
 gi|189036986|sp|A9N9X0|UBIA_COXBR RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|161763232|gb|ABX78874.1| 4-hydroxybenzoate polyprenyl transferase [Coxiella burnetii RSA
           331]
          Length = 287

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 89/284 (31%), Positives = 144/284 (50%), Gaps = 11/284 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L R+    G  L + P LW+  +AA           +  F    I+I G++V R A 
Sbjct: 11  YLRLMRFDKPVGIFLLLWPTLWAVWIAAKG---------APSFKIAVIFIAGSVVMRAAG 61

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLISFVLLLQFNPFVICVG 140
           C  ND  D  +D  V RT+ RPL SG  +  +A L+FAVL  LI+F L+L  N   + + 
Sbjct: 62  CIVNDFADRHLDKHVQRTQMRPLASGSVSVTEAMLLFAVLS-LIAFTLVLLLNRLTVELA 120

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              + ++L+YPF KRF   PQ+ LG+ F+  + + + A        A+ L    + W + 
Sbjct: 121 VIGILLALVYPFLKRFTHLPQLWLGVAFSWSIPMAFAATVGHVPAVAWLLFFAAVLWPIV 180

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT YA  D++DD  +G+ STA LF    +L + +L G  +L F +    L  N++ ++G
Sbjct: 181 YDTQYAMIDREDDVKVGIKSTAILFGRYDRLMIGLLQGSVLLTFGLLGWYLRFNYWFYLG 240

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           LL+AL L   +   +       C + F +   VG  I + ++++
Sbjct: 241 LLVALGLMCYQQFLIRHRKPPDCFAAFRNNNWVGFFIFLGILLT 284


>gi|296284222|ref|ZP_06862220.1| 4-hydroxybenzoate polyprenyltransferase [Citromicrobium
           bathyomarinum JL354]
          Length = 324

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/272 (31%), Positives = 132/272 (48%), Gaps = 10/272 (3%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           LAR+    GW L   PC++   L+          GW   F  L  ++ GAI  RGA C +
Sbjct: 50  LARFDRPIGWWLLFWPCVFGVWLSG--------TGWQ--FGLLLWFLAGAIAMRGAGCVY 99

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND+ D ++D QV RT SRP+ SG+ ++  A ++  +   +  ++LLQ       +  A L
Sbjct: 100 NDITDAELDRQVARTASRPIASGRVSKRTAWIWLAVLSFVGLIVLLQLPLQAQIIALASL 159

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            +   YPF KR    PQ  LG+ F  G+ VGW  L  +    A  + +G + W V +DT+
Sbjct: 160 LLVAAYPFMKRITWWPQAWLGLTFNWGLLVGWATLADTNWGVAIAVYLGCVAWTVGYDTI 219

Query: 205 YAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIA 264
           YA QDK+DD L+G+ S+A     + K  +   Y + V  + + F L+  +  AW+ LL  
Sbjct: 220 YAVQDKEDDALVGIRSSALRMGGKVKQGVAACYALAVALWALGFWLVRADPVAWLTLLPV 279

Query: 265 LFLTIKRIIALDISCSKQCCSFFHSAGVVGIL 296
            +    +++ LD          F +    G L
Sbjct: 280 AWHLGWQVVTLDEKDPGNPLHRFRANRWAGFL 311


>gi|254369048|ref|ZP_04985061.1| 4-hydroxybenzoate octaprenyltransferase [Francisella tularensis
           subsp. holarctica FSC022]
 gi|157121969|gb|EDO66139.1| 4-hydroxybenzoate octaprenyltransferase [Francisella tularensis
           subsp. holarctica FSC022]
          Length = 284

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 111/212 (52%), Gaps = 9/212 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
             +  Y  L R H      L + P L + VLA++ L             YL I+ +G +V
Sbjct: 4   QQLKAYFILMRLHRPIPILLILWPTLTALVLASHGLPDIS---------YLVIFTIGVVV 54

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R   C  ND+ D D D  V RT +RPL SGQ +   A+   +   L++F+ +L  N + 
Sbjct: 55  MRTVGCIINDIADVDFDKHVARTNTRPLTSGQLSIKNAIWLCISLTLVAFICVLFLNLYT 114

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I + F  LF+++LYPF KRF   PQ++LG+ F  G+F+ + A+       A+   I TI 
Sbjct: 115 ILLSFVALFLAILYPFCKRFFAIPQLILGLAFNFGIFMAFSAIQNQIPVEAWIFYIATIC 174

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQ 228
           W + +DT+YA  D++ D  IG+ S+A LF  +
Sbjct: 175 WTIAYDTIYALADREFDLEIGIKSSAVLFGNK 206


>gi|238605318|ref|XP_002396418.1| hypothetical protein MPER_03350 [Moniliophthora perniciosa FA553]
 gi|215468972|gb|EEB97348.1| hypothetical protein MPER_03350 [Moniliophthora perniciosa FA553]
          Length = 207

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 102/187 (54%), Gaps = 5/187 (2%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           +YL R     G  L   PC WS  +A+Y L  +    ++T   Y+ ++ +GA++ RGA C
Sbjct: 1   MYLMRIDKPIGTLLLFYPCTWSITMASYALETS----FTTPLKYISLFGLGALIMRGAGC 56

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFA 142
           T ND+ D  +D  V RTR RPL  G  ++ QALVF   Q      +LLQ N + I +G +
Sbjct: 57  TINDMWDKSLDKSVDRTRERPLAKGVLSQKQALVFLAGQLTAGLGVLLQLNWYSIFLGAS 116

Query: 143 LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTIFWVVYF 201
            L +  +YPF KR    PQ VLG+ F  G  +GW A+  + +W     L  G + W + +
Sbjct: 117 SLSVVTIYPFMKRVTYWPQAVLGLAFNWGALLGWSAVAGAVNWSVCLPLYAGGVAWTLVY 176

Query: 202 DTVYAHQ 208
           DT+YAHQ
Sbjct: 177 DTIYAHQ 183


>gi|295687708|ref|YP_003591401.1| 4-hydroxybenzoate polyprenyl transferase [Caulobacter segnis ATCC
           21756]
 gi|295429611|gb|ADG08783.1| 4-hydroxybenzoate polyprenyl transferase [Caulobacter segnis ATCC
           21756]
          Length = 311

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 99/308 (32%), Positives = 141/308 (45%), Gaps = 25/308 (8%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
            WV D      + P++ L R+    G  L +LP      LAA    R     W      L
Sbjct: 14  NWV-DRYAPERLRPWLKLGRFDRPAGIWLLMLPGWQGVALAAAEQGR-----WPNPLLLL 67

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
            ++ VGA + R A C +ND+VD D D+QV RT  RP+P+G  +  QA  F +   L+SF+
Sbjct: 68  AVF-VGAALMRAAGCAFNDIVDRDFDAQVARTAMRPIPAGLISVKQAWGFLIGCSLVSFL 126

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           +L+      I +G   L +   YPF KR    PQ  LG+ F  G  +G+ A     SW A
Sbjct: 127 ILVCLGWTAILLGVLSLGLVAAYPFMKRITWWPQAWLGLTFNWGALLGYAAAVGHLSWSA 186

Query: 188 FFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA 247
             L    IFW + +DT+YA QD +DD L G+ S+ R      KL +   Y +  +  + A
Sbjct: 187 ALLYGAGIFWTLGYDTIYAIQDIEDDALAGIKSSTRRLGRHVKLGVAGFYVVSTVLVIAA 246

Query: 248 FCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCC---------SFFHSAGVVGILIL 298
                    AW+G L  LFL      AL +S                 F S  V G+L++
Sbjct: 247 ---------AWVGGLGPLFLPFAGAFALHLSRQAAAVRLDDGAGALKLFKSNAVAGLLVV 297

Query: 299 ICLIISLF 306
           + L+  L+
Sbjct: 298 VGLVAGLW 305


>gi|16127651|ref|NP_422215.1| 4-hydroxybenzoate octaprenyltransferase [Caulobacter crescentus
           CB15]
 gi|221236470|ref|YP_002518907.1| 4-hydroxybenzoate polyprenyltransferase [Caulobacter crescentus
           NA1000]
 gi|13425135|gb|AAK25383.1| 4-hydroxybenzoate octaprenyltransferase [Caulobacter crescentus
           CB15]
 gi|220965643|gb|ACL96999.1| 4-hydroxybenzoate polyprenyltransferase [Caulobacter crescentus
           NA1000]
          Length = 328

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 93/295 (31%), Positives = 139/295 (47%), Gaps = 24/295 (8%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           P++ L R+    G  L +LP      LAA    R     W      L ++ VGA + R A
Sbjct: 43  PWLKLGRFDRPVGIWLLMLPGWQGIALAAAEQGR-----WPNPLLLLAVF-VGAALMRAA 96

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C +ND+VD D D+QV RT  RP+P+G  +  QA +F V    +SF++L+      I +G
Sbjct: 97  GCAFNDIVDRDFDAQVARTAMRPIPAGLISVKQAWLFVVGCCGVSFLILICLGWTAILLG 156

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L +   YPF KR    PQ  LG+ F  G  +G+ A     SW A  L    IFW + 
Sbjct: 157 VLSLALVAAYPFMKRITWWPQAWLGLTFNWGALLGYAAATGHLSWSAALLYASGIFWTLG 216

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YA QD +DD L G+ S+ R      ++ +   Y       +V+F LL +    W+G
Sbjct: 217 YDTIYAIQDIEDDALAGIKSSTRRLGQHVQIGVAGFY-------LVSFILLVIA--GWMG 267

Query: 261 LLIALFLTI---------KRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
            +  LFL +         ++  A+ I         F S  + G+L+   L+  L+
Sbjct: 268 DIGPLFLPLAALFALHLSRQAAAVRIEDGPGALKLFKSNALAGLLVFAGLVAGLW 322


>gi|29653416|ref|NP_819108.1| 4-hydroxybenzoate polyprenyl transferase [Coxiella burnetii RSA
           493]
 gi|154705977|ref|YP_001425354.1| 4-hydroxybenzoate polyprenyltransferase [Coxiella burnetii Dugway
           5J108-111]
 gi|165923896|ref|ZP_02219728.1| 4-hydroxybenzoate polyprenyl transferase [Coxiella burnetii RSA
           334]
 gi|212213409|ref|YP_002304345.1| 4-hydroxybenzoate polyprenyltransferase [Coxiella burnetii
           CbuG_Q212]
 gi|81629685|sp|Q83F93|UBIA_COXBU RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|189036985|sp|A9KGW7|UBIA_COXBN RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790264|sp|B6J375|UBIA_COXB2 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|29540678|gb|AAO89622.1| 4-hydroxybenzoate polyprenyltransferase [Coxiella burnetii RSA 493]
 gi|154355263|gb|ABS76725.1| 4-hydroxybenzoate polyprenyltransferase [Coxiella burnetii Dugway
           5J108-111]
 gi|165916650|gb|EDR35254.1| 4-hydroxybenzoate polyprenyl transferase [Coxiella burnetii RSA
           334]
 gi|212011819|gb|ACJ19200.1| 4-hydroxybenzoate polyprenyltransferase [Coxiella burnetii
           CbuG_Q212]
          Length = 287

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 89/284 (31%), Positives = 144/284 (50%), Gaps = 11/284 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L R+    G  L + P LW+  +AA           +  F    I+I G++V R A 
Sbjct: 11  YLRLMRFDKPVGIFLLLWPTLWAVWIAAKG---------APSFKIAVIFIAGSVVMRAAG 61

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLISFVLLLQFNPFVICVG 140
           C  ND  D  +D  V RT+ RPL SG  +  +A L+FAVL  LI+F L+L  N   + + 
Sbjct: 62  CIVNDFADRHLDKHVQRTQMRPLASGSVSVTEAMLLFAVLS-LIAFTLVLLLNRLTVELA 120

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              + ++L+YPF KRF   PQ+ LG+ F+  + + + A        A+ L    + W + 
Sbjct: 121 VIGILLALVYPFLKRFTHLPQLWLGVAFSWSIPMAFAATVGHVPAVAWLLFFAAVLWPIV 180

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT YA  D++DD  +G+ STA LF    +L + +L G  +L F +    L  N++ ++G
Sbjct: 181 YDTQYAMIDREDDVKVGIKSTAILFGRYDRLMIGLLQGSVLLTFGLLGWYLRFNYWFYLG 240

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           LL+AL L   +   +       C + F +   VG  I + ++++
Sbjct: 241 LLVALGLMCYQQFLIRHRKPPDCFAAFRNNNWVGFFIFLGILLT 284


>gi|71734800|ref|YP_277190.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|118574212|sp|Q48BQ5|UBIA_PSE14 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|71555353|gb|AAZ34564.1| 4-hydroxybenzoate polyprenyl transferase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320321731|gb|EFW77829.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320331481|gb|EFW87421.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330880926|gb|EGH15075.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 296

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 121/243 (49%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +A       G     T+F    I++VG  + R A 
Sbjct: 19  FIQLTRIDKPIGIYLLLWPTLWAVWIAG-----KGSPSLKTVF----IFVVGVFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +AL    +   +SFVL+L  N   I + F
Sbjct: 70  CVINDFADRKVDGHVKRTEQRPLISGKVSSREALALFAVLVGLSFVLVLFTNATTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAACYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGDLPAAAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L G+ + C M+A     +    +IGL
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILTLQGLALGCLMLAGARFELGACFYIGL 249

Query: 262 LIA 264
           L A
Sbjct: 250 LAA 252


>gi|260771649|ref|ZP_05880569.1| 4-hydroxybenzoate polyprenyltransferase [Vibrio metschnikovii CIP
           69.14]
 gi|260613426|gb|EEX38625.1| 4-hydroxybenzoate polyprenyltransferase [Vibrio metschnikovii CIP
           69.14]
          Length = 285

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 86/290 (29%), Positives = 144/290 (49%), Gaps = 11/290 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           + +  Y  L R     G  L + P LW+ +LAA  +           F  L +++VG   
Sbjct: 4   AKVHAYWQLMRMDRPIGSLLLLWPTLWALILAAQGMPD---------FHILVVFVVGVFA 54

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  ND  D  +D  V RT  RPLP+G+ +  +A+   ++  ++SF+L+L  NP  
Sbjct: 55  MRSAGCVINDFADRHVDGHVKRTAQRPLPTGKVSEKEAIGLFLVLVILSFLLVLTMNPLT 114

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIG-TI 195
           I +    + ++ +YPF KR+   PQ+ LG+ F+  + + W A  A+   P  +L  G  +
Sbjct: 115 IKLSLVGVLLAFIYPFMKRYTQVPQLFLGLAFSWSIPMAWAA-QANALPPIIWLVFGVNL 173

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W + +DT YA  D+ DD LIGV STA LF  + K  + +L  + ++  +    + ++  
Sbjct: 174 LWTIAYDTQYAMVDRDDDLLIGVKSTAILFGRRDKAIIGVLQLMTIVLLIALGWVYSLGA 233

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
             +  +LIA  L + +   +       C   F +   VG++I + LI+SL
Sbjct: 234 SYYWAILIASGLFVYQQHLIRHRQRMPCFHAFLNNNYVGMVITLGLILSL 283


>gi|146280823|ref|YP_001170976.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas stutzeri
           A1501]
 gi|167011556|sp|A4VGN3|UBIA_PSEU5 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|145569028|gb|ABP78134.1| 4-hydroxybenzoate polyprenyl transferase [Pseudomonas stutzeri
           A1501]
          Length = 297

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 128/244 (52%), Gaps = 11/244 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +AA  +  A           LFI+I G I+ R A 
Sbjct: 19  FIQLMRLDKPIGTYLLLWPTLWALWIAAEGVPSAK---------NLFIFITGVILMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLISFVLLLQFNPFVICVG 140
           C  ND  D + D  V RT++RP+ +G+ +  +A  +FAVL  L SF L+L  N   + + 
Sbjct: 70  CVVNDFADRNFDGHVQRTQARPMAAGRVSSREAWTLFAVLVGL-SFGLVLLTNATTVYLS 128

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
           F  L ++  YPF KR+   PQVVLG  F+ G+ + + A   S    A+ L I  + W V 
Sbjct: 129 FGALALAACYPFMKRYTFYPQVVLGAAFSWGMPMAFTAETGSLPPEAWLLFIANLLWTVA 188

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT YA  D+ DD  IG+ STA LF    ++ +  L G+ + C ++A     +  +  +G
Sbjct: 189 YDTYYAMADRDDDLKIGIKSTAILFGEADRVIIVTLQGLALFCLLLAGVRFELGQWFHLG 248

Query: 261 LLIA 264
           L+IA
Sbjct: 249 LVIA 252


>gi|298489417|ref|ZP_07007428.1| 4-hydroxybenzoate polyprenyltransferase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298155991|gb|EFH97100.1| 4-hydroxybenzoate polyprenyltransferase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 296

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 121/243 (49%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +A       G     T+F    I++VG  + R A 
Sbjct: 19  FIQLTRIDKPIGIYLLLWPTLWAVWIAG-----KGSPSLKTVF----IFMVGVFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +AL    +   +SFVL+L  N   I + F
Sbjct: 70  CVINDFADRKVDGHVKRTEQRPLVSGKVSSREALALFAVLVGLSFVLVLFTNATTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAACYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGDLPAAAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L G+ + C M+A     +    +IGL
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILTLQGLALGCLMLAGARFELGACFYIGL 249

Query: 262 LIA 264
           L A
Sbjct: 250 LAA 252


>gi|254229777|ref|ZP_04923184.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio sp. Ex25]
 gi|262392920|ref|YP_003284774.1| 4-hydroxybenzoate polyprenyltransferase [Vibrio sp. Ex25]
 gi|151937676|gb|EDN56527.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio sp. Ex25]
 gi|262336514|gb|ACY50309.1| 4-hydroxybenzoate polyprenyltransferase [Vibrio sp. Ex25]
          Length = 284

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 86/285 (30%), Positives = 144/285 (50%), Gaps = 13/285 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P +W+ +++A      G+  W        ++++G  + R A 
Sbjct: 9   YWQLMRMDRPIGSLLLMWPTIWALIISA-----QGMPSWDV----FIVFVLGVFLMRSAG 59

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT+ RPLPSG+ T  +A+   ++  + SF+L+L  NP  I + F
Sbjct: 60  CVINDFADRKVDGHVKRTKQRPLPSGKVTAKEAIGLFLVLGISSFLLVLTMNPLTIQLSF 119

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A + ++ +YPF KR+   PQ+ LG+ F+  + + W A         +F+ +    W + +
Sbjct: 120 AGIVLAFIYPFMKRYTHIPQLFLGLAFSWAIPMAWAAQTGELPLIVWFVFLINALWTIAY 179

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIF--VLCFMVAFCLLTVNFFAWI 259
           DT YA  D+ DD  IG+ STA LF    KL + +L  I   +L ++  F  L  +++ W 
Sbjct: 180 DTQYAMVDRDDDLKIGIKSTAILFGRHDKLIIGVLQLITLAMLVWLGQFYQLGQSYY-WT 238

Query: 260 GLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            LLIA  L + +   +     + C   F +   VG++I I L+++
Sbjct: 239 -LLIAASLFVYQQHLIRHRERELCFKAFLNNNYVGMVIAIGLLVA 282


>gi|328675531|gb|AEB28206.1| 4-hydroxybenzoate polyprenyltransferase [Francisella cf. novicida
           3523]
          Length = 272

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 83/278 (29%), Positives = 140/278 (50%), Gaps = 9/278 (3%)

Query: 27  RWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWND 86
           R H      L + P L + VLA++ L             YL I+ +G +V R   C  ND
Sbjct: 2   RLHRPIPILLILWPTLTALVLASHGLPD---------IMYLVIFTIGVVVMRTVGCIVND 52

Query: 87  LVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFI 146
           + D D D  V RT +RPL SGQ +   A+   +   L++F+ +L  N + I + F  LF+
Sbjct: 53  IADVDFDKHVARTNTRPLTSGQLSIKNAIWLCIFLTLVAFICVLFLNLYTILLSFVALFL 112

Query: 147 SLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYA 206
           ++LYPF KRF   PQ++LG+ F  G+F+ + A+       A+   + TI W + +DT+YA
Sbjct: 113 AILYPFCKRFFAIPQLILGLAFNFGIFMAFSAIQNQIPVEAWIFYLSTICWTIAYDTIYA 172

Query: 207 HQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIALF 266
             D++ D  IG+NS+A LF  +   ++ +   + +L  ++       N F ++G++I   
Sbjct: 173 LADREFDLEIGINSSAVLFGNKVFRYILLFNFLSLLLLIILGIYCDFNSFFYLGVIICSL 232

Query: 267 LTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
             I+            C + F +   +G++I I ++I 
Sbjct: 233 FFIRNYFLYKKLGITNCINAFSANHWIGLVIFIMVVIQ 270


>gi|328768167|gb|EGF78214.1| hypothetical protein BATDEDRAFT_3850 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 286

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 91/299 (30%), Positives = 143/299 (47%), Gaps = 29/299 (9%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L R     G  L  LPC ++  +A++    A  +   T    L ++ VG++V R A
Sbjct: 2   PYLLLTRLDKPAGTWLLYLPCTFAIGMASF--YSAETIPIITTLSTLALFGVGSVVMRSA 59

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C  NDL D DID +V RT++RPL SG+   FQA+ +      +   +L + N F I VG
Sbjct: 60  GCIINDLWDIDIDKKVERTKTRPLASGEIKPFQAIAYLGAHLTVGLGILTRLNMFSILVG 119

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF-SWP-AFFLCIGTIFWV 198
            + L +  +YP  KR    PQ  LG+ F  G  +G+ AL      W  A  L +  + W 
Sbjct: 120 ASSLALVAMYPLMKRITYWPQAFLGLTFNWGALLGFTALITDHVPWDVAVPLYLSGVCWT 179

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFA- 257
           + +DT+YA QD+ DD   GV STA            +++G +V   +  F + TV   A 
Sbjct: 180 LVYDTIYALQDRSDDIKAGVKSTA------------VMFGSYVKPILAMFAVGTVGLLAL 227

Query: 258 --WIGLLIALFLTIK----------RIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
             W+    A F T+           +I+ L+++C     + F S    G+++L  +++ 
Sbjct: 228 SGWMNGHSAWFYTVSVGGGILHLGWQILTLNVACRTDAAAKFKSNRNFGLIVLTGILLD 286


>gi|327479091|gb|AEA82401.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas stutzeri DSM
           4166]
          Length = 297

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 121/227 (53%), Gaps = 11/227 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +AA  +  A           LFI+  G I+ R A 
Sbjct: 19  FIQLMRLDKPIGTYLLLWPTLWALWIAAEGVPSAK---------NLFIFTTGVILMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLISFVLLLQFNPFVICVG 140
           C  ND  D + D  V RT++RP+ +G+ +  +A  +FAVL  L SFVL+L  N   + + 
Sbjct: 70  CVVNDFADRNFDGHVQRTQARPMAAGRVSSREAWTLFAVLVGL-SFVLVLLTNATTVYLS 128

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
           F  L ++  YPF KR+   PQVVLG  F+ G+ + + A   S    A+ L I  + W V 
Sbjct: 129 FGALALAACYPFMKRYTFYPQVVLGAAFSWGMPMAFTAETGSLPPEAWLLFIANLLWTVA 188

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA 247
           +DT YA  D++DD  IG+ STA LF    ++ +  L G+ + C ++A
Sbjct: 189 YDTYYAMADREDDLKIGIKSTAILFGEADRIIIVTLQGLALFCLILA 235


>gi|170078009|ref|YP_001734647.1| 4-hydroxybenzoate polyprenyltransferase [Synechococcus sp. PCC
           7002]
 gi|169885678|gb|ACA99391.1| 4-hydroxybenzoate polyprenyl transferase [Synechococcus sp. PCC
           7002]
          Length = 293

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 85/260 (32%), Positives = 126/260 (48%), Gaps = 20/260 (7%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           +YL RW    G  + ++P LW+  LAA          W  +     + I+GAI T  A C
Sbjct: 11  IYLLRWDKPAGRLILIIPALWAVFLAA-----EAKPDWKLVL----VIILGAITTSAAGC 61

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF- 141
             NDL D DID QV RT+ RPL S   T    ++ A+  FL +  L   FNP+   + F 
Sbjct: 62  VVNDLWDRDIDPQVERTKVRPLASKALTVKVGIITAIAFFLCAAGLAFYFNPWTNPLSFW 121

Query: 142 ---ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
              A + + + YP +KRF   PQ+VL I +   V + W A+  + +   + L   T+FW 
Sbjct: 122 LCVAAVPVIIAYPLAKRFFPVPQLVLAIAWGFAVLISWSAVTQNLTAATWLLWGATVFWT 181

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF-- 256
           + FDT+YA  D+ DD  IG+NS+A  F       + I + +   C  +    L +N    
Sbjct: 182 LGFDTIYALSDRDDDLKIGINSSAIFFGKFAPEAVGIFFVLTATCLAILGKTLNINLLIY 241

Query: 257 --AW---IGLLIALFLTIKR 271
             AW   +GL    +L I++
Sbjct: 242 GIAWAIAVGLWFKQYLKIRK 261


>gi|241761628|ref|ZP_04759715.1| 4-hydroxybenzoate polyprenyl transferase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373936|gb|EER63469.1| 4-hydroxybenzoate polyprenyl transferase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 318

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 87/243 (35%), Positives = 121/243 (49%), Gaps = 2/243 (0%)

Query: 65  WYLF-IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
           W+L   + +GA V R A C +ND+VD D+D +V RTR+RPL SG  +   A +F     L
Sbjct: 69  WFLLPAFFIGAFVMRSAGCVYNDIVDRDLDKKVARTRNRPLASGFISVKAACLFIAFLCL 128

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           I    L  FNP       A L +   YPF KR    PQ  LG+ F+    VG  A+   F
Sbjct: 129 IGLGCLTFFNPIARFTAIASLALVAAYPFMKRISWWPQAWLGLVFSWAALVGSVAIWDRF 188

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
            WP  FL  G IFWV+ FDTVYA QD +DD L G+ S+AR      +L + + + + VL 
Sbjct: 189 EWPGIFLYGGCIFWVIGFDTVYAIQDIEDDALAGIKSSARALKSHLRLGVSLFFVLAVLG 248

Query: 244 FMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVG-ILILICLI 302
           +  A           + LL  +   I ++  LD++  +     F S   +G +L L C  
Sbjct: 249 WGAAIWFTRPQPLVLLTLLPVVLHFIWQMTTLDVNDGQNALMRFRSNRQIGFLLFLACAT 308

Query: 303 ISL 305
           I +
Sbjct: 309 IGM 311


>gi|118496992|ref|YP_898042.1| prenyltransferase [Francisella tularensis subsp. novicida U112]
 gi|194324226|ref|ZP_03058000.1| 4-hydroxybenzoate polyprenyl transferase [Francisella tularensis
           subsp. novicida FTE]
 gi|254372351|ref|ZP_04987842.1| 4-hydroxybenzoate octaprenyltransferase [Francisella tularensis
           subsp. novicida GA99-3549]
 gi|167011548|sp|A0Q4X3|UBIA_FRATN RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|118422898|gb|ABK89288.1| 4-hydroxybenzoate octaprenyltransferase [Francisella novicida U112]
 gi|151570080|gb|EDN35734.1| 4-hydroxybenzoate octaprenyltransferase [Francisella novicida
           GA99-3549]
 gi|194321673|gb|EDX19157.1| 4-hydroxybenzoate polyprenyl transferase [Francisella tularensis
           subsp. novicida FTE]
          Length = 284

 Score =  126 bits (317), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 111/212 (52%), Gaps = 9/212 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
             +  Y  L R H      L + P L + VLA++ L             YL I+ +G +V
Sbjct: 4   QQLKAYFMLMRLHRPIPILLILWPTLTALVLASHGLPDIS---------YLVIFTIGVVV 54

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R   C  ND+ D D D  V RT +RPL SGQ +   A+   +   L++F+ +L  N + 
Sbjct: 55  MRTVGCIINDIADVDFDKHVARTNTRPLTSGQLSIKNAIWLCISLTLVAFICVLFLNLYT 114

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I + F  LF+++LYPF KRF   PQ++LG+ F  G+F+ + A+       A+   + TI 
Sbjct: 115 ILLSFVALFLAILYPFCKRFFAIPQLILGLAFNFGIFMAFSAIQNQIPVEAWIFYLATIC 174

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQ 228
           W + +DT+YA  D++ D  IG+ S+A LF  +
Sbjct: 175 WTIAYDTIYALADREFDLEIGIKSSAVLFGNK 206


>gi|188535221|ref|YP_001909018.1| 4-hydroxybenzoate octaprenyltransferase [Erwinia tasmaniensis
           Et1/99]
 gi|188030263|emb|CAO98150.1| 4-hydroxybenzoate octaprenyltransferase [Erwinia tasmaniensis
           Et1/99]
          Length = 282

 Score =  126 bits (317), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 90/250 (36%), Positives = 121/250 (48%), Gaps = 23/250 (9%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S ++ Y  L R     G  L + P LW+  LA   +    VL          ++++G   
Sbjct: 2   SKLSAYCRLMRIDKPIGSLLLLWPTLWALWLAGMQVPPLKVL---------LVFVLGVFF 52

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQ-CTRFQALVFAVLQFLISFVLLLQFNPF 135
            R A C  ND  D  ID  V RTR+RPLPSG   TR   L+FA L  LISF+L+L  N  
Sbjct: 53  MRAAGCVVNDFADRKIDGHVKRTRARPLPSGAVSTREAKLLFAGL-VLISFMLVLTMNSM 111

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTI 195
            + +    L ++ +YPF KR+   PQVVLG  F   + + W A+  S     + L +  I
Sbjct: 112 TLWLSLGGLGLAWMYPFMKRYTHLPQVVLGAAFGWAIPMAWAAVSESVPLTCWLLFLANI 171

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W V +DT YA  D+ DD  IGV STA LF    KL    + G+  L  M+         
Sbjct: 172 CWTVAYDTQYAMVDRDDDLKIGVKSTAILFGRYDKL----IIGLLQLATMI--------L 219

Query: 256 FAWIGLLIAL 265
            AW+G  +AL
Sbjct: 220 LAWVGRQLAL 229


>gi|39973573|ref|XP_368177.1| hypothetical protein MGG_01067 [Magnaporthe oryzae 70-15]
 gi|145017976|gb|EDK02255.1| hypothetical protein MGG_01067 [Magnaporthe oryzae 70-15]
          Length = 417

 Score =  126 bits (317), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 111/221 (50%), Gaps = 18/221 (8%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPL-----RRAGVLGWSTIFWYLFIYIVGAI 75
           PY  L R     G +    PCL+ST++AA PL       A VLG + +F+       GA+
Sbjct: 103 PYAELMRIDKPIGTYYLFFPCLFSTLMAA-PLATPMATPASVLGTTALFF------TGAL 155

Query: 76  VTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPF 135
           + RGA CT NDL D ++D  V RTR RP+  G  T F+A+ F   Q L    +LLQF   
Sbjct: 156 IMRGAGCTINDLWDRNLDPHVERTRLRPIARGAITPFKAVAFTGAQLLTGLAVLLQFPVS 215

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF---SW---PAFF 189
            +  G   L +  LYP +KR    PQ VLG+ F+ G  +G+ AL        W    A  
Sbjct: 216 CLFYGVPSLVLVTLYPLAKRVTYYPQAVLGLTFSWGAIMGFPALGVDLLANEWALASAAL 275

Query: 190 LCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
           L    I W V +D +YAH D KDD   G+ S A    ++TK
Sbjct: 276 LYSSNIAWTVLYDMIYAHMDAKDDVKAGIKSIALKHFHETK 316


>gi|208780448|ref|ZP_03247788.1| 4-hydroxybenzoate polyprenyl transferase [Francisella novicida FTG]
 gi|208743594|gb|EDZ89898.1| 4-hydroxybenzoate polyprenyl transferase [Francisella novicida FTG]
          Length = 284

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 111/212 (52%), Gaps = 9/212 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
             +  Y  L R H      L + P L + VLA++ L             YL I+ +G +V
Sbjct: 4   QQLKAYFMLMRLHRPIPILLILWPTLTALVLASHGLPDIS---------YLVIFTIGVVV 54

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R   C  ND+ D D D  V RT +RPL SGQ +   A+   +   L++F+ +L  N + 
Sbjct: 55  MRTVGCIINDIADVDFDKHVARTNTRPLTSGQLSIKNAIWLCISLTLVAFICVLFLNLYT 114

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I + F  LF+++LYPF KRF   PQ++LG+ F  G+F+ + A+       A+   + TI 
Sbjct: 115 ILLSFVALFLAILYPFCKRFFAIPQLILGLAFNFGIFMAFSAIQNQIPVEAWIFYLATIC 174

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQ 228
           W + +DT+YA  D++ D  IG+ S+A LF  +
Sbjct: 175 WTIAYDTIYALADREFDLEIGIKSSAVLFGNK 206


>gi|222086493|ref|YP_002545027.1| 4-hydroxybenzoate polyprenyl transferase [Agrobacterium radiobacter
           K84]
 gi|221723941|gb|ACM27097.1| 4-hydroxybenzoate polyprenyl transferase [Agrobacterium radiobacter
           K84]
          Length = 304

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 120/246 (48%), Gaps = 15/246 (6%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAA---YPLRRAGVLGWSTIFWYLFIYIVGAIVT 77
           P+  LAR     G  L + PC W+ ++ A   +P  R            L I+ +GA++ 
Sbjct: 28  PFARLARLDRPVGIWLTLFPC-WAALVQASHGFPDLR-----------QLAIFSLGALLM 75

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           R A  T ND+ D   D  V RTR RPL SGQ    QAL F  +Q  ++  LL    P+  
Sbjct: 76  RSAGSTVNDIADRKFDGHVERTRFRPLASGQTGVPQALAFLAIQLALAASLLSFLTPYTR 135

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFW 197
            V   +L +  +YP  KRF   PQ VLG  F  G+ + W  +       A  +  G I W
Sbjct: 136 LVAICVLPLVFVYPLCKRFTHWPQAVLGAAFNWGMLMAWAEVTGHIPLGAVLMWAGAIAW 195

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFA 257
            + +DTVYA+ D +DD  +G+ STA LF    K+W+ + Y + V  + +   LL ++   
Sbjct: 196 QIGYDTVYAYVDVRDDSRLGLKSTAILFGRNGKIWIGVFYALTVGAWSLGGWLLGMSLPY 255

Query: 258 WIGLLI 263
             G+L+
Sbjct: 256 ANGMLV 261


>gi|294142648|ref|YP_003558626.1| 4-hydroxybenzoate polyprenyl transferase [Shewanella violacea
           DSS12]
 gi|293329117|dbj|BAJ03848.1| 4-hydroxybenzoate polyprenyl transferase [Shewanella violacea
           DSS12]
          Length = 287

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 122/226 (53%), Gaps = 9/226 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ LAR     G  L + PCL + +LAA  +    VL          I+I+G +V R   
Sbjct: 11  YMRLARMDRPIGTLLLLWPCLMALILAADGMPDLKVL---------VIFILGVVVMRACG 61

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D ++DS V RT+SRPL SG+ +  +AL+   +  L +F L+L  NP VI + F
Sbjct: 62  CIINDYADRELDSHVDRTKSRPLASGEISSKEALLLFGVMGLFAFGLVLMLNPLVIQLSF 121

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + ++++YPF+KRF   PQ+ LG+ ++  + + + A   S    A++L      W V +
Sbjct: 122 VGIILTVIYPFTKRFTNMPQMFLGVVWSWSIPMAYAAQTGSVPAEAWWLFFANWCWTVAY 181

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA 247
           DT+YA  D++DD  +G+ STA LF    +  + +     + CF+ A
Sbjct: 182 DTMYAMVDREDDLQVGIKSTAILFGKYDRQIIGLFQLAALACFITA 227


>gi|292489793|ref|YP_003532683.1| 4-hydroxybenzoate-octaprenyltransferase [Erwinia amylovora
           CFBP1430]
 gi|292897993|ref|YP_003537362.1| 4-hydroxybenzoate octaprenyltransferase [Erwinia amylovora ATCC
           49946]
 gi|291197841|emb|CBJ44936.1| 4-hydroxybenzoate octaprenyltransferase [Erwinia amylovora ATCC
           49946]
 gi|291555230|emb|CBA23489.1| 4-hydroxybenzoate-octaprenyltransferase [Erwinia amylovora
           CFBP1430]
 gi|312173978|emb|CBX82232.1| 4-hydroxybenzoate-octaprenyltransferase [Erwinia amylovora ATCC
           BAA-2158]
          Length = 287

 Score =  126 bits (316), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 83/226 (36%), Positives = 110/226 (48%), Gaps = 17/226 (7%)

Query: 10  VRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAY---PLRRAGVLGWSTIFWY 66
           +   +  S  + Y  L R     G  L + P LW+  LA     PL+             
Sbjct: 1   MEKSVQMSKFSAYCRLMRIDKPIGSLLLLWPTLWALWLAGMQVPPLK------------V 48

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLIS 125
           L ++++G    R A C  ND  D +ID  V RTR RPLPSG  T  +A L+FA L  LIS
Sbjct: 49  LLVFVLGVFFMRAAGCVVNDFADRNIDGHVKRTRERPLPSGAVTAREAKLLFAGL-VLIS 107

Query: 126 FVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW 185
           F L++  N   I +    L ++ +YPF KR+   PQVVLG  F   + + W A+  S   
Sbjct: 108 FALVMTMNSMTIWLSLGGLGLAWMYPFMKRYTHLPQVVLGAAFGWAIPMAWAAVSESVPL 167

Query: 186 PAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
             + L +  I W V +DT YA  D+ DD  IGV STA LF    KL
Sbjct: 168 TCWLLFLANICWTVAYDTQYAMVDRDDDVKIGVKSTAILFGRYDKL 213


>gi|18389306|dbj|BAB84122.1| PGT-1 [Lithospermum erythrorhizon]
          Length = 307

 Score =  126 bits (316), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 91/299 (30%), Positives = 135/299 (45%), Gaps = 20/299 (6%)

Query: 12  DCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAA----YPLRRAGVLGWSTIFWYL 67
           +  +   + PY +LAR     G  L   P  WS  LAA     P +   + GW    W +
Sbjct: 19  EMYLPKEVRPYAHLARLDKPIGSWLLAWPAFWSVALAADLESLP-KMLAIFGW----WAV 73

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
           +I        RGA CT ND  D + D +V RT+SRPL SG  +  Q L +   Q  I   
Sbjct: 74  WI--------RGAGCTINDYFDRNFDKKVERTKSRPLASGAVSPAQGLWWLAFQLFIGLG 125

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP- 186
           +L QFN   + +    +     YP  KR    PQ  LG+  + G  +G  AL  S   P 
Sbjct: 126 VLYQFNVLTLALAIVHVPFVFAYPLMKRITYWPQAFLGVMISWGALLGSSALKGSVV-PS 184

Query: 187 -AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFM 245
            A+ L I + FW + +DT+YAHQDK DD   G+ STA  F   TK+W+       +   +
Sbjct: 185 IAYPLYISSFFWTLVYDTIYAHQDKVDDAKAGIKSTALRFGDATKMWISWFGVGCIAALV 244

Query: 246 VAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           +   +L +    ++ + IA    + +I  +D+     C   F S    G +I   +++ 
Sbjct: 245 IGGLILNIGLPYYVFVAIATGQLVWQIFTVDLLSPLDCGKKFVSNQWFGAIIFTGILLG 303


>gi|56707962|ref|YP_169858.1| 4-hydroxybenzoate polyprenyltransferase [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110670433|ref|YP_666990.1| 4-hydroxybenzoate polyprenyltransferase [Francisella tularensis
           subsp. tularensis FSC198]
 gi|224457043|ref|ZP_03665516.1| prenyltransferase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|254370450|ref|ZP_04986455.1| 4-hydroxybenzoate octaprenyltransferase [Francisella tularensis
           subsp. tularensis FSC033]
 gi|254874764|ref|ZP_05247474.1| 4-hydroxybenzoate octaprenyltransferase [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|81597592|sp|Q5NGI4|UBIA_FRATT RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|118574202|sp|Q14HY6|UBIA_FRAT1 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|56604454|emb|CAG45489.1| 4-hydroxybenzoate octaprenyltransferase [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110320766|emb|CAL08872.1| 4-hydroxybenzoate octaprenyltransferase [Francisella tularensis
           subsp. tularensis FSC198]
 gi|151568693|gb|EDN34347.1| 4-hydroxybenzoate octaprenyltransferase [Francisella tularensis
           subsp. tularensis FSC033]
 gi|254840763|gb|EET19199.1| 4-hydroxybenzoate octaprenyltransferase [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|282159148|gb|ADA78539.1| prenyltransferase [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 284

 Score =  126 bits (316), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 110/212 (51%), Gaps = 9/212 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
             +  Y  L R H      L + P L + VLA++ L             YL I+ +G +V
Sbjct: 4   QQLKAYFMLMRLHRPIPILLILWPTLTALVLASHGLPDIS---------YLVIFTIGVVV 54

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R   C  ND+ D D D  V RT +RPL SGQ +   A+   +   L++F+ +L  N + 
Sbjct: 55  MRTVGCIINDIADVDFDKHVARTNTRPLTSGQLSIKNAIWLCISLTLVAFICVLFLNLYT 114

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I + F  LF+++LYPF KRF   PQ++LG+ F  G+F+ +  +       A+   I TI 
Sbjct: 115 ILLSFVALFLAILYPFCKRFFAIPQLILGLAFNFGIFMAFSTIQNQIPVEAWIFYIATIC 174

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQ 228
           W + +DT+YA  D++ D  IG+ S+A LF  +
Sbjct: 175 WTIAYDTIYALADREFDLEIGIKSSAVLFGNK 206


>gi|156087537|ref|XP_001611175.1| prenyltransferase, UbiA family protein [Babesia bovis]
 gi|154798429|gb|EDO07607.1| prenyltransferase, UbiA family protein [Babesia bovis]
          Length = 388

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 91/296 (30%), Positives = 143/296 (48%), Gaps = 12/296 (4%)

Query: 11  RDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIY 70
           R   +  +I  Y  L R  +     +   P LWS+ +A      +   G+  +   + ++
Sbjct: 90  RGRSINESITIYGNLMRLQNLAPVGIFAFPALWSSFMAI-----SSTWGYEEL-KKMVLF 143

Query: 71  IVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLL 130
            +GA   R A C  ND+ D +ID  V RT++RP+ +G  +  +AL        +  ++LL
Sbjct: 144 CLGAFFGRNAGCCINDMADRNIDKYVERTKTRPMAAGLLSTREALCVLSANAALGLLVLL 203

Query: 131 QFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFL 190
           QF+   I +G      S +YPF KR+   P + LG+     V++ W A+  +F+    FL
Sbjct: 204 QFDIRTIRIGILTAIGSCVYPFMKRYTNFPPLFLGLATNLSVYIAWSAIAPTFTLAPSFL 263

Query: 191 CIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFMVAFC 249
            I +  W + +DTVYAHQD K D  IGV S A  +   TK    +   GI  L     + 
Sbjct: 264 YIASNLWTLIYDTVYAHQDLKYDRKIGVKSLAIYWGDNTKKNCKLCSIGISTLLVAAGYA 323

Query: 250 LLTVNFFAWIGLLIAL--FLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLII 303
               N   W   LIAL  F   ++I A+D+  +KQC SFF  + + G L+L  +++
Sbjct: 324 SGLNN---WYYGLIALSHFWMNRQINAVDLKDAKQCLSFFKRSVIYGALVLTAVVL 376


>gi|260949024|ref|XP_002618809.1| hypothetical protein CLUG_02268 [Clavispora lusitaniae ATCC 42720]
 gi|238848681|gb|EEQ38145.1| hypothetical protein CLUG_02268 [Clavispora lusitaniae ATCC 42720]
          Length = 393

 Score =  125 bits (315), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 88/292 (30%), Positives = 145/292 (49%), Gaps = 7/292 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWY-LFIYIVGAIVTRG 79
           PY  L R     G  L ++P  W   +A+Y     G+     +F   + ++ +GA+V RG
Sbjct: 104 PYFELMRLEKPVGTLLLLIPSFWGITMASY-----GITASFPVFASAIGLFSIGALVMRG 158

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICV 139
           A CT ND+ D ++D+QV RT  RP+ SG+ +  QA+ + V Q L+   +LL        +
Sbjct: 159 AGCTINDIWDRNLDNQVARTMERPITSGRVSVPQAVTWMVAQCLVGLAILLSLPFECFYL 218

Query: 140 GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFS-WPAFFLCIGTIFWV 198
           G   L     YP  KRF   PQVVL I F+ G  +G+ A+ A+ + W A  L +    W 
Sbjct: 219 GALSLPFVAAYPLFKRFTHYPQVVLSICFSWGCLLGFPAVGAALNLWVAGPLFLSNFLWC 278

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT+YAHQDK  D   G+ STA  +  +TK  ++ +  + V  F+ A  + ++  F +
Sbjct: 279 MIYDTIYAHQDKNYDIKAGIKSTALAWGDKTKPIMYAMGSLQVASFLTAGVMNSMGPFFY 338

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
           +          ++I  +++   K C + F      G ++ + ++I   L  F
Sbjct: 339 LTACWGFSRLFQQIKKVNLDDPKSCWAAFTGNIRTGEILWLGMLIDYLLKLF 390


>gi|330898756|gb|EGH30175.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 308

 Score =  125 bits (315), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 121/243 (49%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +A       G     T+F    I+++G  + R A 
Sbjct: 19  FIQLTRIDKPIGVYLLLWPTLWAVWIAG-----KGAPSLQTVF----IFVLGVFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +ALV   +   +SFVL+L  N   I +  
Sbjct: 70  CVINDFADRKVDGHVKRTEQRPLVSGKVSSREALVLFAVLVGLSFVLVLFTNAATIWLSV 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAASYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGELPAAAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L G+ + C M+A     +    +IGL
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILTLQGLALGCLMLAGARFELGACFYIGL 249

Query: 262 LIA 264
           L A
Sbjct: 250 LAA 252


>gi|330952445|gb|EGH52705.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae Cit
           7]
          Length = 297

 Score =  125 bits (315), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 82/243 (33%), Positives = 122/243 (50%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +A       G     T+F    I+++G  + R A 
Sbjct: 19  FIQLTRIDKPIGVYLLLWPTLWAVWIAG-----KGAPSLQTVF----IFVLGVFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +ALV   +   +SFVL+L  N   I + F
Sbjct: 70  CVINDFADRKVDGHVKRTEQRPLVSGKVSSREALVLFAVLVGLSFVLVLFTNATTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAASYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGELPAAAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L G+ + C ++A     +    ++GL
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILTLQGLALGCLILAGARFELGACFYVGL 249

Query: 262 LIA 264
           L A
Sbjct: 250 LAA 252


>gi|295095408|emb|CBK84498.1| 4-hydroxybenzoate octaprenyltransferase [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 288

 Score =  125 bits (315), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 97/286 (33%), Positives = 143/286 (50%), Gaps = 15/286 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  +A       GV       W L +++ G  + R A 
Sbjct: 13  YHRLMRTDKPIGALLLLWPTLWALWVAT-----PGV----PPLWILAVFVAGVWLMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D   D  V RT +RPLPSGQ T  +A +  V+  L+SF+L+L  N   I +  
Sbjct: 64  CVVNDYADRKFDGHVKRTANRPLPSGQVTGKEARILFVVLVLLSFMLVLTLNTMTILLSV 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++ +YPF KR+   PQVVLG  F   + + + A+  S     + + +  I W V +
Sbjct: 124 AALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWAVAY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLT-VNFFAWIG 260
           DT YA  D+ DD  IG+ STA LF    KL + IL  + VL  MVA   L  +N+  +  
Sbjct: 184 DTQYAMVDRDDDLKIGIKSTAILFGRHDKLIIGILQ-VAVLALMVAIGRLNGLNWEFYWS 242

Query: 261 LLIA--LFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           +L+A  LF   +++IA      + C   F +   VG+++ + L +S
Sbjct: 243 VLVAGLLFAYQQKLIA--KREREACFKAFLNNNYVGLVLFLGLAMS 286


>gi|156331149|ref|XP_001619154.1| hypothetical protein NEMVEDRAFT_v1g152225 [Nematostella vectensis]
 gi|156201770|gb|EDO27054.1| predicted protein [Nematostella vectensis]
          Length = 292

 Score =  125 bits (315), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 129/244 (52%), Gaps = 10/244 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+   A+  +  A           LFI++VG ++ R A 
Sbjct: 19  FIQLMRLDKPIGIYLLLWPTLWALWGASEGVPSAK---------NLFIFVVGVLLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D + D  V RT++RPL SG+    +AL+   +   +SFVL+L  N   I + F
Sbjct: 70  CVINDYADRNFDGHVSRTKARPLASGKVKPREALILFAVLVALSFVLVLFTNTTTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP-AFFLCIGTIFWVVY 200
             L ++  YPF KR+   PQVVLG  F+ G+ + + A+      P A+ L I  + W V 
Sbjct: 130 GGLTLAACYPFMKRYTFYPQVVLGAAFSWGMPMAFSAVTGEMPPPEAWLLYIANLLWTVA 189

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT YA  D++DD  IGV STA LF    +L + IL G+ +LC ++A     +  +  +G
Sbjct: 190 YDTYYAMADREDDLKIGVRSTAILFGDADRLIIVILQGLALLCLLLAAARFELGLYFHLG 249

Query: 261 LLIA 264
           LL A
Sbjct: 250 LLAA 253


>gi|85078920|ref|XP_956256.1| hypothetical protein NCU01553 [Neurospora crassa OR74A]
 gi|11595556|emb|CAC18141.1| related to para-hydroxybenzoate polyprenyltransferase precursor
           [Neurospora crassa]
 gi|28917311|gb|EAA27020.1| hypothetical protein NCU01553 [Neurospora crassa OR74A]
          Length = 422

 Score =  125 bits (315), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 90/220 (40%), Positives = 116/220 (52%), Gaps = 17/220 (7%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LAR    TG +    PCL+ST+LAA PL  AG     ++     ++I GAI+ RGA
Sbjct: 113 PYAELARLDKPTGSYYLFFPCLFSTLLAA-PL--AGPASPVSVVGTSLLFISGAIIMRGA 169

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C  NDL D ++D  V RTR RP+     T FQ LVF   Q L    +LLQF PF  C  
Sbjct: 170 GCAINDLWDRNLDPHVTRTRLRPIARRAITPFQGLVFTGSQLLAGLAVLLQF-PFE-CFW 227

Query: 141 FA---LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL-------HASFSWPAFFL 190
           +A   LLF++  YP +KR    PQ VLG+ F+ G  +G+ AL        A+ +  A  L
Sbjct: 228 YATPSLLFVA-SYPLAKRVTYYPQFVLGLTFSWGAIMGFPALGVDLLANQAALTA-AGCL 285

Query: 191 CIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
               I W V +D +YAH D KDD   G+ S A     +TK
Sbjct: 286 YTSNIAWTVLYDMIYAHMDIKDDAKAGIKSIALKHDKETK 325


>gi|257485716|ref|ZP_05639757.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|331012000|gb|EGH92056.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 296

 Score =  125 bits (315), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 120/243 (49%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +A       G     T+F    I++VG  + R A 
Sbjct: 19  FIQLTRIDKPIGIYLLLWPTLWAVWIAG-----KGSPSLKTVF----IFVVGVFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +AL    +   +SFVL+L  N   I + F
Sbjct: 70  CVINDFADRKVDGHVKRTEQRPLVSGKVSSREALALFAVLVGLSFVLVLFTNATTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAACYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGDLPAAAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L G+ + C M+A     +    + GL
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILTLQGLALGCLMLAGARFELGACFYTGL 249

Query: 262 LIA 264
           L A
Sbjct: 250 LAA 252


>gi|242067078|ref|XP_002454828.1| hypothetical protein SORBIDRAFT_04g038180 [Sorghum bicolor]
 gi|241934659|gb|EES07804.1| hypothetical protein SORBIDRAFT_04g038180 [Sorghum bicolor]
          Length = 435

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 93/261 (35%), Positives = 123/261 (47%), Gaps = 48/261 (18%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
           KWV +     A  PY  LAR     G  L   PC+WS  +AA P       G       L
Sbjct: 113 KWVPE-----AARPYAMLARLDKPIGTWLLAWPCMWSITIAATP-------GELPDLKML 160

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
            ++  GA++ RGA CT NDL+D DID++V RT++RP  SG  T  Q + F  +Q L+   
Sbjct: 161 ALFGCGAVLLRGAGCTVNDLLDRDIDNKVERTKTRPFASGVLTPLQGVGFLGIQLLLGLG 220

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           +LLQ N +   +G + LF+   YP  KRF   PQ  LG+ F  G  +GW A+  S   PA
Sbjct: 221 ILLQLNNYSRILGASSLFLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAIKESLD-PA 279

Query: 188 FFLCIGT--IFWVVYFDTVYAH---------------------------------QDKKD 212
             L + T  I W + +DT+YAH                                 QDK+D
Sbjct: 280 IILPLYTAGICWTLVYDTIYAHQVFHYSCSSILILDENGHFMLSECLIHVYLHASQDKED 339

Query: 213 DELIGVNSTARLFSYQTKLWL 233
           D  +GV STA  F   TK W+
Sbjct: 340 DLKVGVKSTALRFGDLTKYWI 360


>gi|121997756|ref|YP_001002543.1| 4-hydroxybenzoate octaprenyltransferase [Halorhodospira halophila
           SL1]
 gi|121589161|gb|ABM61741.1| 4-hydroxybenzoate octaprenyltransferase [Halorhodospira halophila
           SL1]
          Length = 299

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 119/231 (51%), Gaps = 9/231 (3%)

Query: 15  MGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGA 74
           +G  +  Y  LAR     G  L + P LW+  +AA     AGV         L I+ +G 
Sbjct: 16  VGERLRTYAQLARLDRPIGNFLLLWPVLWALWIAA-----AGVPDLD----LLVIFTLGV 66

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
           +V R A C  ND  D  ID  V RTR RP  +G+ +  +AL+  V+  L++F L+L  NP
Sbjct: 67  VVMRAAGCVINDFADRHIDGHVKRTRQRPFATGRVSEREALLLFVVLCLLAFGLVLLTNP 126

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT 194
             I +    + ++  YPF+KR+   PQV LG+ F   V + + A   +    A+ L I T
Sbjct: 127 LTILMSLVAVVLAATYPFTKRYTHLPQVHLGLAFGWAVPMVFAAQTGTVPVVAWLLLIAT 186

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFM 245
           + W   +DT+YA  D+ DD  IGV STA LF    +L + IL G+ +L  +
Sbjct: 187 VLWATVYDTMYAMVDRDDDIKIGVKSTAVLFGDLDRLMIAILQGLMLLAMV 237


>gi|115314268|ref|YP_762991.1| 4-hydroxybenzoate polyprenyltransferase [Francisella tularensis
           subsp. holarctica OSU18]
 gi|118574204|sp|Q0BNI0|UBIA_FRATO RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|115129167|gb|ABI82354.1| 4-hydroxybenzoate octaprenyltransferase [Francisella tularensis
           subsp. holarctica OSU18]
          Length = 284

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 110/212 (51%), Gaps = 9/212 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
             +  Y  L R H      L + P L + VLA++ L             YL I+ +G +V
Sbjct: 4   QQLKAYFMLMRLHRPIPILLILWPTLTALVLASHGLPDIS---------YLVIFTIGVVV 54

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R   C  ND+ D D D  V RT +RPL SGQ +   A+   +   L++F+ +L  N + 
Sbjct: 55  MRTVGCIINDIADVDFDKHVARTNTRPLTSGQLSIKNAIWLCISLTLVAFICVLFLNLYT 114

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I + F  LF+++LYPF KRF   PQ++LG+ F  G+F+ + A+       A+   I TI 
Sbjct: 115 ILLSFVALFLAILYPFCKRFFAIPQLILGLAFNFGIFMAFSAIQNQIPVEAWIFYIATIC 174

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQ 228
           W + +DT+YA  D++ D   G+ S+A LF  +
Sbjct: 175 WTIAYDTIYALADREFDLETGIKSSAVLFGNK 206


>gi|94496118|ref|ZP_01302696.1| 4-hydroxybenzoate polyprenyl transferase [Sphingomonas sp. SKA58]
 gi|94424297|gb|EAT09320.1| 4-hydroxybenzoate polyprenyl transferase [Sphingomonas sp. SKA58]
          Length = 301

 Score =  125 bits (314), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 105/198 (53%), Gaps = 9/198 (4%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           LAR     GW L   P  W+  LA       G   W  I W L     G+I  RGA C +
Sbjct: 28  LARLDRPIGWWLLFWPGAWAVALAG-----GGFARWPLIAWLLL----GSIAMRGAGCVF 78

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND+VD D+D +V RT +RPL SG      A V+ +   L+  V+L+Q  P+   V    L
Sbjct: 79  NDIVDRDLDLKVARTAARPLASGTMALKTAWVWLLALCLVGLVVLVQLRPYAQVVALCSL 138

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            +   YPF KR    PQV LG+ F+    VGW  +  + + P   L  G+IFWV+ +DT+
Sbjct: 139 ALVAAYPFMKRITGWPQVWLGLVFSWACLVGWSEVAGALTTPGLLLYAGSIFWVIGYDTI 198

Query: 205 YAHQDKKDDELIGVNSTA 222
           YA QD++DD LIG+ S+A
Sbjct: 199 YALQDREDDALIGIGSSA 216


>gi|163859182|ref|YP_001633480.1| 4-hydroxybenzoate octaprenyltransferase [Bordetella petrii DSM
           12804]
 gi|163262910|emb|CAP45213.1| 4-hydroxybenzoate-octaprenyl transferase [Bordetella petrii]
          Length = 308

 Score =  125 bits (314), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 87/252 (34%), Positives = 118/252 (46%), Gaps = 27/252 (10%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAA---YPLRRAGVLGWSTIFWYLFIYIVG 73
            A  PY  L R     G  L +LPC+ + V AA     LRR            L ++ +G
Sbjct: 27  RAWRPYARLCRLDRPIGTWLTLLPCIAALVQAAGGLPELRR------------LIVFSLG 74

Query: 74  AIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFN 133
           A++ RG  CT ND+ D DID  V RTR RPL SGQ +   A+ F + Q L+   LL   N
Sbjct: 75  ALLMRGIGCTVNDMCDRDIDKHVERTRFRPLTSGQLSMRNAVWFLLGQLLVCGSLLFFIN 134

Query: 134 PFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIG 193
                +  A+L    +YP  KR    PQVVLGI F  G+ + W             + +G
Sbjct: 135 EMSRWLAVAVLPFVFIYPLCKRVTYWPQVVLGICFNWGMLMAWSDTQNFLPLAGIAMWLG 194

Query: 194 TIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTV 253
            + W V +D++YA+ D +DD  +G+ STA  F  + KLW+   Y              TV
Sbjct: 195 AVLWQVGYDSIYAYVDVRDDRQLGLRSTAMRFGARGKLWIGGFYAA------------TV 242

Query: 254 NFFAWIGLLIAL 265
             +AW G  I L
Sbjct: 243 ALWAWGGYAIGL 254


>gi|149235029|ref|XP_001523393.1| para-hydroxybenzoate-polyprenyltransferase, mitochondrial precursor
           [Lodderomyces elongisporus NRRL YB-4239]
 gi|146452802|gb|EDK47058.1| para-hydroxybenzoate-polyprenyltransferase, mitochondrial precursor
           [Lodderomyces elongisporus NRRL YB-4239]
          Length = 377

 Score =  125 bits (314), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 95/303 (31%), Positives = 146/303 (48%), Gaps = 11/303 (3%)

Query: 9   WVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLF 68
           W++ C       PY+ L R     G  L +LPC W+  +A+Y +        +T    + 
Sbjct: 78  WLKKC--PEKWIPYLELMRLEKPVGTLLLLLPCYWAITMASYSIHAP----LATTATAVG 131

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           ++  GA++ RGA CT ND+ D ++D+QV RT  RP+ SG+ T  QA+ +  +Q      +
Sbjct: 132 LFSAGALIMRGAGCTINDIWDRNLDNQVARTMERPITSGRVTVPQAVAWLGVQCFAGLAV 191

Query: 129 LLQFNPFV--ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFS-W 185
           LL   PF       F+L F+   YP  KRF   PQ +L I F+ G  +G+ A+ A  + W
Sbjct: 192 LLSL-PFECFYLGAFSLPFV-FAYPLFKRFTYYPQAILSICFSWGCLLGFPAVGAPLNLW 249

Query: 186 PAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFM 245
            A  L I    W + +DT+YAHQDKK D   G+ STA  +   TK  L  L       + 
Sbjct: 250 VALPLFISNWIWCLTYDTIYAHQDKKYDIKAGIKSTALAWGSNTKPILKGLTAAQAGFYA 309

Query: 246 VAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
           +A  + ++    +I    A+     +II +++   K C S F S    G +    ++   
Sbjct: 310 MAGVMNSMGPGFYIAGAFAIARIYNQIIKVNLDDEKSCWSAFTSNIQTGFIFWYGILFDY 369

Query: 306 FLD 308
           FL 
Sbjct: 370 FLQ 372


>gi|254373823|ref|ZP_04989306.1| 4-hydroxybenzoate octaprenyltransferase [Francisella novicida
           GA99-3548]
 gi|151571544|gb|EDN37198.1| 4-hydroxybenzoate octaprenyltransferase [Francisella novicida
           GA99-3548]
          Length = 284

 Score =  125 bits (314), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 111/212 (52%), Gaps = 9/212 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
             +  Y  L R H      L + P L + VLA++ L             YL I+ +G ++
Sbjct: 4   QQLKAYFMLMRLHRPIPILLILWPTLTALVLASHGLPDIS---------YLVIFTIGVVL 54

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R   C  ND+ D D D  V RT +RPL SGQ +   A+   +   L++F+ +L  N + 
Sbjct: 55  MRTVGCIINDIADVDFDKHVARTNTRPLTSGQLSIKNAIWLCISLTLVAFICVLFLNLYT 114

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I + F  LF+++LYPF KRF   PQ++LG+ F  G+F+ + A+       A+   + TI 
Sbjct: 115 ILLSFVALFLAILYPFCKRFFAIPQLILGLAFNFGIFMAFSAIQNQIPVEAWIFYLATIC 174

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQ 228
           W + +DT+YA  D++ D  IG+ S+A LF  +
Sbjct: 175 WTIAYDTIYALADREFDLEIGIKSSAVLFGNK 206


>gi|330505653|ref|YP_004382522.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas mendocina
           NK-01]
 gi|328919939|gb|AEB60770.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas mendocina
           NK-01]
          Length = 296

 Score =  125 bits (314), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 110/210 (52%), Gaps = 9/210 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +AA      GV         LFI++VG I+ R A 
Sbjct: 19  FIQLMRLEKPIGIYLLLWPTLWALWVAA-----EGVPSLKN----LFIFVVGVILMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D + D  V RT+ RPL SG+    +ALV   +   +SFVL+L  N   I + F
Sbjct: 70  CVINDYADRNFDGHVSRTQLRPLASGKVKPREALVLFAVLVAMSFVLVLFTNATTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A   S    A+ L I  + W V +
Sbjct: 130 GGLALAACYPFMKRYTFYPQVVLGAAFSWGMPMAFTAETGSLPPEAWLLYIANLLWTVAY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
           DT YA  D++DD  IGV STA LF    +L
Sbjct: 190 DTYYAMADREDDLKIGVKSTAILFGDADRL 219


>gi|239818022|ref|YP_002946932.1| 4-hydroxybenzoate polyprenyl transferase [Variovorax paradoxus
           S110]
 gi|239804599|gb|ACS21666.1| 4-hydroxybenzoate polyprenyl transferase [Variovorax paradoxus
           S110]
          Length = 286

 Score =  125 bits (314), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 92/254 (36%), Positives = 134/254 (52%), Gaps = 13/254 (5%)

Query: 14  IMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLF-IYIV 72
           ++    A Y+ L RW+   GW L + P L +   AA         GW    W+L  ++++
Sbjct: 1   MLARRFALYLDLIRWNRPAGWLLLLWPTLGALWFAAE--------GWPG--WHLLAVFVL 50

Query: 73  GAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQF 132
           G I+ R A C  ND+ D D D  V RT  RP+ SG  +  +ALV   +  L++F L+L  
Sbjct: 51  GTILMRSAGCCVNDVADRDFDRHVKRTAQRPVTSGAVSVREALVLGAVLALLAFGLVLTT 110

Query: 133 NPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI 192
           N   I   FA L I+L YPF+KRF+  PQ VLGI F+ G+ + + A+ A+    A +L  
Sbjct: 111 NRLTILWSFAALAITLAYPFAKRFVSVPQAVLGIAFSFGIPMAFAAVQATVPVFAAWLLA 170

Query: 193 GTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIF--VLCFMVAFCL 250
           G +FWV+ +DT YA  D+ DD  IG+ ++A  F       +   YG+F  V  +  A   
Sbjct: 171 GNLFWVLAYDTEYAMVDRDDDLKIGMKTSAITFGRFDVAAVMASYGLFLAVWAWAGASRG 230

Query: 251 LTVNFFAWIGLLIA 264
           L   FFA IG+ +A
Sbjct: 231 LGAVFFAAIGIALA 244


>gi|146309423|ref|YP_001189888.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas mendocina ymp]
 gi|167011554|sp|A4Y0P0|UBIA_PSEMY RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|145577624|gb|ABP87156.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas mendocina ymp]
          Length = 296

 Score =  125 bits (314), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 109/210 (51%), Gaps = 9/210 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +AA  +  A           LFI++ G I+ R A 
Sbjct: 19  FIQLMRLDKPIGIYLLLWPTLWALWVAAEGVPSAK---------NLFIFVFGVILMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D + D  V RTR+RPL SG+    +ALV   +    SFVL+L  N   I + F
Sbjct: 70  CVINDYADRNFDGHVSRTRARPLASGKIQPREALVLFAVLVTASFVLVLFTNATTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A   S    A+ L I  + W V +
Sbjct: 130 GGLALAACYPFMKRYTFYPQVVLGAAFSWGMPMAFTAETGSLPPEAWLLYIANLLWTVAY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
           DT YA  D++DD  IGV STA LF    +L
Sbjct: 190 DTYYAMADREDDLKIGVKSTAILFGDADRL 219


>gi|288940237|ref|YP_003442477.1| 4-hydroxybenzoate polyprenyl transferase [Allochromatium vinosum
           DSM 180]
 gi|288895609|gb|ADC61445.1| 4-hydroxybenzoate polyprenyl transferase [Allochromatium vinosum
           DSM 180]
          Length = 300

 Score =  125 bits (314), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 112/211 (53%), Gaps = 11/211 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R H   G  L + P LW+  LA      AG   WS +     I+++G ++ R A 
Sbjct: 23  YYLLVRLHRPIGIFLLMWPALWALWLAG-----AGQPHWSVVL----IFVLGVVLMRSAG 73

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQAL-VFAVLQFLISFVLLLQFNPFVICVG 140
           C  ND  D   D  V RT  RPL +GQ T  +A+ VF VL  LI+F L+LQ N   I + 
Sbjct: 74  CAINDYADRHFDGHVARTNQRPLATGQVTPREAIGVFMVLS-LIAFALVLQLNWQTIALS 132

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
           F  L ++ +YPF KRF   PQ+ LG  F   + + + A+  +  + A+ L + T+ W + 
Sbjct: 133 FVALALTFVYPFMKRFTHVPQLFLGAAFGWAIPMAFAAITGTIPFYAWVLFVATLIWALI 192

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
           +DT YA  D++DD  IG+ STA LF    +L
Sbjct: 193 YDTQYAMVDREDDLKIGIKSTAILFGRWDRL 223


>gi|254293385|ref|YP_003059408.1| 4-hydroxybenzoate polyprenyl transferase [Hirschia baltica ATCC
           49814]
 gi|254041916|gb|ACT58711.1| 4-hydroxybenzoate polyprenyl transferase [Hirschia baltica ATCC
           49814]
          Length = 309

 Score =  125 bits (314), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 88/248 (35%), Positives = 129/248 (52%), Gaps = 10/248 (4%)

Query: 20  APYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRG 79
            PY  L+R+    G  L  +P  W   +A    R   +  WS +   + I+I GAI  RG
Sbjct: 26  EPYCRLSRYDRPIGIWLLAIPG-W---IAIAFTRLNELPHWSDLQLAILIFI-GAIAMRG 80

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICV 139
           A CT+ND++D D D++V RT  RP+P+G+ +  +A ++ ++Q  I   +LL        V
Sbjct: 81  AGCTYNDILDKDFDAKVDRTAGRPIPAGRVSVKKAWIWTLIQCSIGLCVLLTLPRTAQIV 140

Query: 140 GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVV 199
               + +   YP  KR    PQ  LG  F   + V   A++         L +G +FW +
Sbjct: 141 SLLSIPLIAAYPLMKRITWWPQAWLGFTFNWAILVAIAAVNQRIEMADMILYLGFVFWTI 200

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWI 259
            +DT+YA QD +DD +IGV STAR F  + +   FILYG+ V+    A CLL     A I
Sbjct: 201 GYDTIYALQDIEDDAMIGVKSTARRFGAKVQSATFILYGLSVILVSTA-CLLKQ---API 256

Query: 260 GLL-IALF 266
           GLL +A+F
Sbjct: 257 GLLGVAIF 264


>gi|167644331|ref|YP_001681994.1| 4-hydroxybenzoate polyprenyl transferase [Caulobacter sp. K31]
 gi|167346761|gb|ABZ69496.1| 4-hydroxybenzoate polyprenyl transferase [Caulobacter sp. K31]
          Length = 312

 Score =  125 bits (313), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 93/298 (31%), Positives = 143/298 (47%), Gaps = 24/298 (8%)

Query: 18  AIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVT 77
           A+ P++ L R+    G  L +LP      LAA     AG   W      L  + VGA + 
Sbjct: 25  ALQPWLKLGRFDRPAGIWLLMLPGWQGIALAA-----AGKGQWPNPR-LLIAFFVGAALM 78

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           R A C +ND+VD D D+QV RT  RP+P+G  +  QA  F +   L+S ++LL      I
Sbjct: 79  RAAGCAFNDIVDRDFDAQVSRTAMRPIPAGLISVKQAWAFVIGCCLVSLLILLCLGWLAI 138

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFW 197
            +G   L +   YPF KR    PQ  LG+ F  G  +G+ A   + +WPA  L    +FW
Sbjct: 139 GLGVLSLGLVAAYPFMKRITWWPQAWLGLTFNWGALLGYAAATHTLAWPAVLLYASGLFW 198

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFA 257
            + +DT+YA QD +DD L GV S+AR         +   Y   ++CF++          A
Sbjct: 199 TLGYDTIYAVQDLEDDALAGVKSSARRLGEAAPRGVLAFY---IVCFVLVIAA------A 249

Query: 258 WIGLLIALFLTIKRIIALDISCSKQ---------CCSFFHSAGVVGILILICLIISLF 306
           W+G +  LFL +  + A+ +S               + F S  + G+++ + L+  ++
Sbjct: 250 WVGDVGPLFLPLAALYAVHLSRQAARLRIDDPVGALALFKSNTLAGLVLFLALVAGMW 307


>gi|71891817|ref|YP_277546.1| 4-hydroxybenzoate octaprenyltransferase [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|118574189|sp|Q494A7|UBIA_BLOPB RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|71795923|gb|AAZ40674.1| 4-hydroxybenzoate octaprenyl transferase [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 290

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 116/219 (52%), Gaps = 13/219 (5%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           L R +   G+ L + P LW   L+   +    VL          +++ GA+  R A C  
Sbjct: 17  LMRINQPIGFFLLLWPTLWGLWLSHKGIPDKVVL---------IVFVAGALCMRSAGCII 67

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND VD+DID  V RT++RPLPSG   + +ALV   +   I+F+L+L  N   I +    L
Sbjct: 68  NDYVDYDIDGHVQRTKTRPLPSGMIRKKEALVALSILLFIAFILVLSLNFITIFLSVVAL 127

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            +S +YP+ KR+I  PQV+LG+ F+  + + + A++   +  A+ L +    W + +DT 
Sbjct: 128 ILSWIYPYLKRYIYFPQVMLGLLFSWPILMAFTAINNPINSTAWLLFLMNTVWTIVYDTQ 187

Query: 205 YAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
           YA  D++DD  +G+ S+A LF    K     L GI  LC
Sbjct: 188 YAMIDREDDIYVGIKSSAVLFGDMDKF----LIGILQLC 222


>gi|58696999|ref|ZP_00372476.1| 4-hydroxybenzoate octaprenyltransferase [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|58536749|gb|EAL60005.1| 4-hydroxybenzoate octaprenyltransferase [Wolbachia endosymbiont of
           Drosophila simulans]
          Length = 232

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 111/216 (51%)

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           R A C  ND+ D  ID+ V RT+ RPL SG     QAL    L   I+ V+LL  N   +
Sbjct: 2   RPAGCIINDIFDRKIDAHVERTKYRPLASGALNIKQALALLSLLLSIALVILLLTNKTTL 61

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFW 197
            +G   + +   YP  KR++  PQ+ LG  F  G  +G  A+    S  +    IG +FW
Sbjct: 62  ILGIISMCMIATYPLLKRYVWWPQLFLGFTFNMGSLMGSAAITNQISIESLLFYIGCVFW 121

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFA 257
            + +DT+YAHQDKKDDE +G+ STA  F   TK WL   Y I ++ ++ A  L ++N   
Sbjct: 122 TLSYDTIYAHQDKKDDEKLGMKSTALYFGDTTKSWLKRFYLISLMTWLYAGILSSLNNIF 181

Query: 258 WIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVV 293
           +I LL   F+  ++    +     QC S F +   V
Sbjct: 182 YIALLAVGFIFHRQCKNFNPDDPSQCMSIFKNNSYV 217


>gi|62258825|gb|AAX77822.1| unknown protein [synthetic construct]
          Length = 319

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 110/212 (51%), Gaps = 9/212 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
             +  Y  L R H      L + P L + VLA++ L             YL I+ +G +V
Sbjct: 30  QQLKAYFMLMRLHRPIPILLILWPTLTALVLASHGLPDIS---------YLVIFTIGVVV 80

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R   C  ND+ D D D  V RT +RPL SGQ +   A+   +   L++F+ +L  N + 
Sbjct: 81  MRTVGCIINDIADVDFDKHVARTNTRPLTSGQLSIKNAIWLCISLTLVAFICVLFLNLYT 140

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I + F  LF+++LYPF KRF   PQ++LG+ F  G+F+ +  +       A+   I TI 
Sbjct: 141 ILLSFVALFLAILYPFCKRFFAIPQLILGLAFNFGIFMAFSTIQNQIPVEAWIFYIATIC 200

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQ 228
           W + +DT+YA  D++ D  IG+ S+A LF  +
Sbjct: 201 WTIAYDTIYALADREFDLEIGIKSSAVLFGNK 232


>gi|332036060|gb|EGI72537.1| 4-hydroxybenzoate polyprenyltransferase [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 292

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 141/287 (49%), Gaps = 17/287 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L R     G  L + P  W+  LA          G  ++  ++ I+ +G +V R A 
Sbjct: 14  YIQLMRIDKPIGTLLLLWPTYWALWLANS--------GMPSLLNFI-IFTLGVVVMRSAG 64

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  ID  V RT  RPL SGQ +  +AL   +L  +I+F+L+L  +   I + F
Sbjct: 65  CVINDFADRKIDGSVKRTAQRPLASGQVSSGEALSLFLLLIVIAFILVLMLSVNTILLSF 124

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F   + + + A   +    A+ L I  I W V +
Sbjct: 125 GALALAFCYPFMKRYTQLPQVVLGAAFGWAIPMAYMASINALPQQAWLLFIANICWTVAY 184

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFC----LLTVNFFA 257
           DT+YA  D+ DD  IGV STA LF    +  +F+L  +F++  +VAF      L+V F  
Sbjct: 185 DTMYAMVDRDDDLKIGVKSTAILFGKYDRHIIFLLNAVFIV--LVAFIGISNHLSVAF-- 240

Query: 258 WIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            +GL IA  L   +   +       C   F +   VG+ I I L++S
Sbjct: 241 GVGLSIAAGLLAYQQTLIHKRERDACFKAFLNNHYVGLAIFIGLLLS 287


>gi|82523702|emb|CAI78483.1| 4-hydroxybezoate polyprenyltransfrease [uncultured beta
           proteobacterium]
          Length = 289

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 116/240 (48%), Gaps = 21/240 (8%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW   LA++     G   W  I W   I+++G ++ R A 
Sbjct: 10  YEKLMRLDKPIGILLLLWPTLWGQWLASH-----GHPDW-LILW---IFVMGVVLMRSAG 60

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D D D  V RTR RPL +G+    +AL+ A    +++F+L+L  +  VI +  
Sbjct: 61  CVINDYADRDFDKHVARTRERPLAAGKVAPKEALLLAAGLSVLAFLLILPLDNLVIGLSV 120

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             LF++  YPF+KRF   PQ  LGI F  G+ + + AL       A+ L +   FW + +
Sbjct: 121 VALFLAASYPFTKRFFAIPQAYLGIAFGFGIPMSYAALWGEVPLEAWVLLLANTFWAIAY 180

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D++DD  IG+ ++A  F                LC+       T+   AW+GL
Sbjct: 181 DTQYAMVDREDDLKIGIKTSAITFGKHD-------LTAIALCYAA-----TLGLLAWVGL 228


>gi|312963902|ref|ZP_07778373.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas fluorescens
           WH6]
 gi|311281937|gb|EFQ60547.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas fluorescens
           WH6]
          Length = 296

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/243 (32%), Positives = 122/243 (50%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +A            S     + I+++G ++TR   
Sbjct: 19  FIQLTRMDKPIGIYLLLWPTLWALWIAGKG---------SPSLANIVIFVLGVVLTRAGG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +ALVF  L   +SF+L+L  N   I +  
Sbjct: 70  CVINDWADRKVDGHVKRTAQRPLASGKISSKEALVFFALLMAVSFLLVLLTNATTILLSL 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAASYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGDLPATAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L G+ ++C ++A     +  +  +GL
Sbjct: 190 DTYYAMTDRDDDLKIGVKSTAILFGDADRVIILTLQGLALVCMLLAGVRFELGGWFHLGL 249

Query: 262 LIA 264
           L A
Sbjct: 250 LAA 252


>gi|254421520|ref|ZP_05035238.1| 4-hydroxybenzoate polyprenyl transferase [Synechococcus sp. PCC
           7335]
 gi|196189009|gb|EDX83973.1| 4-hydroxybenzoate polyprenyl transferase [Synechococcus sp. PCC
           7335]
          Length = 284

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 86/288 (29%), Positives = 141/288 (48%), Gaps = 15/288 (5%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           V L RW    G  + ++P LW+  LA   L    +LG         + ++G + T    C
Sbjct: 8   VRLLRWDKPEGRLILMIPALWAIFLAERGLPDLPLLG---------VIVLGTLATSAGGC 58

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP--FVICVG 140
             NDL D DID QV RTR+RPL +   +    +  A++ FL ++ L    NP  F +CV 
Sbjct: 59  VVNDLWDRDIDPQVERTRNRPLAAKALSAKVGIAVALVSFLCAWGLSFYLNPTSFWLCV- 117

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L + +LYP +KR    PQ+VL I +   V + W A+  +  +  + L   T+FW + 
Sbjct: 118 -AALPVIVLYPLAKRVFPVPQLVLSIAWGFAVLISWSAVTGTIEFATWLLWAATVFWTLG 176

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           FDTVYA  D+  D  +G+NS+A  F  +    + + Y   VL  +    ++++  F W+ 
Sbjct: 177 FDTVYAIPDRDFDRKLGINSSALFFGSRVPQAVGLFYLGTVLMLLWLGLVMSLGIFYWLS 236

Query: 261 LLIALFLTIKRIIALD--ISCSKQCCSFFHSAGVVGILILICLIISLF 306
           L I+ +L  ++   L    +  K   + F     +G ++L  + +S+ 
Sbjct: 237 LAISTYLWYRQYRQLTHFPTSPKVFSNLFRQNVTIGFILLAGMALSVL 284


>gi|51013645|gb|AAT93116.1| YNR041C [Saccharomyces cerevisiae]
          Length = 372

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 138/296 (46%), Gaps = 14/296 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L  LPC WS ++ A  + +   L  S     L I+ VGA+V RGA
Sbjct: 82  PYAELMRLEKPVGTWLLYLPCSWSILMGA--MMQGATL--SATAGMLGIFGVGALVMRGA 137

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT ND +D  +D +V+R+  RP+ SG+ +  +ALVF   Q L+   +L         +G
Sbjct: 138 GCTINDFLDRKLDQRVIRSVERPIASGRVSPRRALVFLGAQTLVGMGVLSLLPAQCWWLG 197

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTIFWVV 199
            A L I   YP  KRF   PQ  L   F  G  +G+ A+    SWP    L + +  W +
Sbjct: 198 LASLPIVFTYPLFKRFTYYPQAALSACFNWGALLGFPAMGV-MSWPTMIPLYLSSYLWCM 256

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA----FCLLTVNF 255
            +DT+YAHQDKK D   G+ STA  +  +TK  +  +    +    VA      L    F
Sbjct: 257 TYDTIYAHQDKKFDIKTGIKSTALAWGPRTKSIMKAMSASQIALLAVAGLNSGLLWGPGF 316

Query: 256 FAWIGLLI-ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
              +G+    LF  IK++   D+   K C  +F++    G+     L +   L  F
Sbjct: 317 IGGLGVFAYRLFSMIKKV---DLDNPKNCWKYFNANINTGLYFTYALAVDYILRLF 369


>gi|116252735|ref|YP_768573.1| 4-hydroxybenzoate polyprenyltransferase [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115257383|emb|CAK08478.1| putative 4-hydroxybenzoate octaprenyltransferase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 304

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 84/263 (31%), Positives = 127/263 (48%), Gaps = 10/263 (3%)

Query: 1   MSQFFNFKWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGW 60
           +S      WV D  + +A  PY  LAR     G  L + PC  + + A++ L   G L  
Sbjct: 9   LSDIHRGDWV-DRRLPAAWRPYTRLARLDRPVGIWLTLFPCWAALIQASHGL---GDLR- 63

Query: 61  STIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVL 120
                 L I+ +GA++ R A  T ND+ D   D  V RTR RPL SG+ T   A VF  +
Sbjct: 64  -----QLAIFSLGALLMRSAGSTVNDIADRKFDGHVERTRFRPLASGEITTLPAFVFLAV 118

Query: 121 QFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALH 180
           +  ++  LL    P+   +   +L +  +YP  KRF   PQ +LG  F  G+ + W    
Sbjct: 119 ELALAASLLFFLTPYTRLIAICVLPLVFIYPLCKRFTNWPQAILGAAFNWGMLMAWAEAA 178

Query: 181 ASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIF 240
                 A  +  G I W + +DT+YA+ D KDD  +G+ STA LF    K ++ + Y + 
Sbjct: 179 GHIPVGAVLMWAGAIAWQIGYDTIYAYVDLKDDTRLGLKSTAILFGRHGKTFIGLFYALA 238

Query: 241 VLCFMVAFCLLTVNFFAWIGLLI 263
           V  + +   LL ++    IG+L+
Sbjct: 239 VGAWSLGGWLLEMSPPYAIGMLL 261


>gi|330831585|ref|YP_004394537.1| 4-hydroxybenzoate octaprenyltransferase [Aeromonas veronii B565]
 gi|328806721|gb|AEB51920.1| 4-hydroxybenzoate octaprenyltransferase [Aeromonas veronii B565]
          Length = 289

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/244 (32%), Positives = 123/244 (50%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
            W L +++VG  + R A C  ND  D + D  V RT  RPLP+G+   ++ L    +  L
Sbjct: 45  LWVLTVFVVGVFLMRSAGCVINDYADRNFDGHVKRTAGRPLPTGRVKPWEVLALFFVLAL 104

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           ISF L+L  NP  I + F  L +++ YPF KRFI  PQ+VLG+ F+  + + + A   + 
Sbjct: 105 ISFGLVLTMNPLTIGLSFVALLLAVSYPFMKRFISNPQLVLGMAFSWSIPMAYAAQADAL 164

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
              A+ L    + W V +DT YA  D+ DD  IG+ S+A LF    K  + +L    +L 
Sbjct: 165 PLVAWLLFFANLLWTVAYDTQYAMVDRDDDLKIGLKSSAILFGRYDKRIIGVLQLSTLLL 224

Query: 244 FMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLII 303
            +    L+T+  + + GLL A  L + +   +     + C   F +   VG L+   L++
Sbjct: 225 LLAVGQLMTLGGWYYWGLLGAAVLFVYQQRLIRERQREACFQAFLNNNYVGALVFAGLVL 284

Query: 304 SLFL 307
              L
Sbjct: 285 DYLL 288


>gi|284006469|emb|CBA71729.1| 4-hydroxybenzoate octaprenyltransferase [Arsenophonus nasoniae]
          Length = 290

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 92/290 (31%), Positives = 144/290 (49%), Gaps = 19/290 (6%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P  W+  +A+         G   +F  L I+ VG  + R A 
Sbjct: 15  YFRLMRLDKPIGILLLLWPTYWALWIASR--------GLPDLF-ILLIFTVGVFLMRAAG 65

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D   D  V RTR RPLP+G  T  +A    +   +I+F+L+L  N   I +  
Sbjct: 66  CVINDFADRKFDGYVARTRERPLPNGDVTEKEAKTLFLSLIIIAFILVLTLNKMAIWLSV 125

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++ +YPF KRF   PQ+VLG  F   + + + A+  S     + L +  I W V +
Sbjct: 126 IGLLLAWIYPFIKRFSHFPQIVLGAAFGWSIPMAYAAVSKSLPLECWLLFLVNIIWSVVY 185

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY--GIFVLCFMVAFCLLTVNFFAWI 259
           DT YA  D+ DD  IG+ STA +F++  KL + IL    I VL ++     L V ++A +
Sbjct: 186 DTQYAMVDRNDDIKIGIKSTAIIFAHFDKLIIGILQLAMILVLFYIGQQLDLGVPYYASL 245

Query: 260 GLLIALFLTIKRIIALDISCSKQ---CCSFFHSAGVVGILILICLIISLF 306
             ++ LF+  +++IA     S+Q   C   F +   VG+++ I ++++ F
Sbjct: 246 IFVLVLFIHQQKLIA-----SRQPALCFKAFMNNNYVGLVLFIGILLNYF 290


>gi|189037057|sp|A1WVM9|UBIA_HALHL RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
          Length = 280

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 116/224 (51%), Gaps = 9/224 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  LAR     G  L + P LW+  +AA     AGV         L I+ +G +V R A 
Sbjct: 4   YAQLARLDRPIGNFLLLWPVLWALWIAA-----AGVPDLD----LLVIFTLGVVVMRAAG 54

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  ID  V RTR RP  +G+ +  +AL+  V+  L++F L+L  NP  I +  
Sbjct: 55  CVINDFADRHIDGHVKRTRQRPFATGRVSEREALLLFVVLCLLAFGLVLLTNPLTILMSL 114

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + ++  YPF+KR+   PQV LG+ F   V + + A   +    A+ L I T+ W   +
Sbjct: 115 VAVVLAATYPFTKRYTHLPQVHLGLAFGWAVPMVFAAQTGTVPVVAWLLLIATVLWATVY 174

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFM 245
           DT+YA  D+ DD  IGV STA LF    +L + IL G+ +L  +
Sbjct: 175 DTMYAMVDRDDDIKIGVKSTAVLFGDLDRLMIAILQGLMLLAMV 218


>gi|77361233|ref|YP_340808.1| 4-hydroxybenzoate octaprenyltransferase [Pseudoalteromonas
           haloplanktis TAC125]
 gi|118574215|sp|Q3IHW5|UBIA_PSEHT RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|76876144|emb|CAI87366.1| 4-hydroxybenzoate octaprenyltransferase [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 292

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 88/288 (30%), Positives = 135/288 (46%), Gaps = 9/288 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S I  Y+ L R     G  L + P  W+  LA      AG+   +       ++ +G ++
Sbjct: 9   SHIPYYIALMRIDKPIGTLLLLWPTYWALWLA-----NAGMPSLTN----FIVFTLGVVI 59

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  ND  D  ID  V RT  RPL SGQ +  +A+   +L   ++F+L+L  +   
Sbjct: 60  MRSAGCVINDFADRKIDGSVKRTMQRPLVSGQVSSGEAISLFILLITVAFLLVLMLSVNT 119

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I + F  L ++  YPF KR+   PQVVLG  F   + + + A   +    A+ L I  I 
Sbjct: 120 ILLSFGALALAFCYPFMKRYTQLPQVVLGAAFGWAIPMAFMASINALPIQAWLLFIANIC 179

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
           W V +DT+YA  D+ DD  IGV STA LF    +  + +L   F+   +    L  +   
Sbjct: 180 WTVAYDTMYAMVDRDDDLKIGVKSTAILFGKYDRHIIGLLNLAFIALMLSIGALNNIGLS 239

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            W+GL +A+ L + + + +       C   F +   VG+   I L+ S
Sbjct: 240 YWLGLSVAIVLLVYQQVLIQQRARTDCFKAFLNNHYVGLAFFIGLLFS 287


>gi|224049266|ref|XP_002190238.1| PREDICTED: similar to para-hydroxybenzoate-polyprenyltransferase,
           mitochondrial [Taeniopygia guttata]
          Length = 417

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 112/214 (52%), Gaps = 11/214 (5%)

Query: 96  VLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKR 155
           V RT SRPL +G  + FQ+LVF   Q  ++  +LL  N + I +G A L + + YP  KR
Sbjct: 204 VARTASRPLAAGDISTFQSLVFLGGQLSLALCVLLCLNYYSIILGAASLLLVITYPLMKR 263

Query: 156 FILCPQVVLGIGFAGGVFVGWGALHASFSW----PAFFLCIGTIFWVVYFDTVYAHQDKK 211
               PQ+VLG  F  G  +GW A+  S  W    P +F     + W + +DT+YAHQDK+
Sbjct: 264 VTYWPQLVLGFTFNWGALLGWSAIKGSCEWSVCLPLYF---AGVMWTLVYDTIYAHQDKR 320

Query: 212 DDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTI 269
           DD +IGV STA  F   TK WL  F L  +  LC     C  T  +++ +  + A     
Sbjct: 321 DDIMIGVKSTALQFKEDTKQWLSGFSLAMLLSLCMAGMNCNQTFPYYSAVAAVGAHL--A 378

Query: 270 KRIIALDISCSKQCCSFFHSAGVVGILILICLII 303
            +I  LDI   + C   F S   VGI++ I +++
Sbjct: 379 HQIYTLDIDKPEDCWKKFASNRTVGIMLFIGIVL 412


>gi|300714893|ref|YP_003739696.1| 4-hydroxybenzoate octaprenyltransferase [Erwinia billingiae Eb661]
 gi|299060729|emb|CAX57836.1| 4-hydroxybenzoate octaprenyltransferase [Erwinia billingiae Eb661]
          Length = 288

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 94/290 (32%), Positives = 138/290 (47%), Gaps = 13/290 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S    Y  L R     G  L + P  W+  LA   +    +L          ++++G   
Sbjct: 2   SKFRAYSRLMRIDKPIGSLLLMWPTFWALWLAGMQIPPLNIL---------IVFVLGVFF 52

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLISFVLLLQFNPF 135
            R A C  ND  D  ID  V RT+SRPLPSG  T  +A L+FA L  L+SF L+L  N  
Sbjct: 53  MRAAGCVVNDFADRKIDGHVKRTQSRPLPSGAVTSKEAKLLFAGL-VLVSFCLVLTMNAM 111

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTI 195
            I + F  L ++ +YPF KR+   PQVVLG  F   + +GW A+  +     + L    I
Sbjct: 112 TIWLSFGGLALAWVYPFMKRYTHLPQVVLGAAFGWAIPMGWAAVSETVPLTCWLLFAANI 171

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFMVAFCLLTVN 254
            W V +DT+YA  D+ DD  IGV STA LF    KL + +L     VL  ++ + +    
Sbjct: 172 CWTVAYDTLYAMVDRDDDLKIGVKSTAILFGRFDKLIVGLLQLATLVLMAVIGWRMQLGG 231

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            F W  +L+A  L + +   +       C   F +   VG+++ + + +S
Sbjct: 232 AFYW-SILVAGALFVHQQKLISARERDPCFQAFLNNNYVGLVLFLGIALS 280


>gi|207341551|gb|EDZ69576.1| YNR041Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256273370|gb|EEU08308.1| Coq2p [Saccharomyces cerevisiae JAY291]
 gi|259148992|emb|CAY82236.1| Coq2p [Saccharomyces cerevisiae EC1118]
 gi|323331782|gb|EGA73195.1| Coq2p [Saccharomyces cerevisiae AWRI796]
 gi|323335755|gb|EGA77036.1| Coq2p [Saccharomyces cerevisiae Vin13]
 gi|323346763|gb|EGA81044.1| Coq2p [Saccharomyces cerevisiae Lalvin QA23]
 gi|323352484|gb|EGA84985.1| Coq2p [Saccharomyces cerevisiae VL3]
          Length = 372

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 138/296 (46%), Gaps = 14/296 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L  LPC WS ++ A  + +   L  S     L I+ VGA+V RGA
Sbjct: 82  PYAELMRLEKPVGTWLLYLPCSWSILMGA--MMQGATL--SATAGMLGIFGVGALVMRGA 137

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT ND +D  +D +V+R+  RP+ SG+ +  +ALVF   Q L+   +L         +G
Sbjct: 138 GCTINDFLDRKLDQRVIRSVERPIASGRVSPRRALVFLGAQTLVGMGVLSLLPAQCWWLG 197

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTIFWVV 199
            A L I   YP  KRF   PQ  L   F  G  +G+ A+    SWP    L + +  W +
Sbjct: 198 LASLPIVFTYPLFKRFTYYPQAALSACFNWGALLGFPAMGV-MSWPTMIPLYLSSYLWCM 256

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA----FCLLTVNF 255
            +DT+YAHQDKK D   G+ STA  +  +TK  +  +    +    VA      L    F
Sbjct: 257 TYDTIYAHQDKKFDIKAGIKSTALAWGPRTKSIMKAMSASQIALLAVAGLNSGLLWGPGF 316

Query: 256 FAWIGLLI-ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
              +G+    LF  IK++   D+   K C  +F++    G+     L +   L  F
Sbjct: 317 IGGLGVFAYRLFSMIKKV---DLDNPKNCWKYFNANINTGLYFTYALAVDYILRLF 369


>gi|190408960|gb|EDV12225.1| polyprenyl transferase [Saccharomyces cerevisiae RM11-1a]
          Length = 371

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 138/296 (46%), Gaps = 14/296 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L  LPC WS ++ A  + +   L  S     L I+ VGA+V RGA
Sbjct: 81  PYAELMRLEKPVGTWLLYLPCSWSILMGA--MMQGATL--SATAGMLGIFGVGALVMRGA 136

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT ND +D  +D +V+R+  RP+ SG+ +  +ALVF   Q L+   +L         +G
Sbjct: 137 GCTINDFLDRKLDQRVIRSVERPIASGRVSPRRALVFLGAQTLVGMGVLSLLPAQCWWLG 196

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTIFWVV 199
            A L I   YP  KRF   PQ  L   F  G  +G+ A+    SWP    L + +  W +
Sbjct: 197 LASLPIVFTYPLFKRFTYYPQAALSACFNWGALLGFPAMGV-MSWPTMIPLYLSSYLWCM 255

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA----FCLLTVNF 255
            +DT+YAHQDKK D   G+ STA  +  +TK  +  +    +    VA      L    F
Sbjct: 256 TYDTIYAHQDKKFDIKAGIKSTALAWGPRTKSIMKAMSASQIALLAVAGLNSGLLWGPGF 315

Query: 256 FAWIGLLI-ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
              +G+    LF  IK++   D+   K C  +F++    G+     L +   L  F
Sbjct: 316 IGGLGVFAYRLFSMIKKV---DLDNPKNCWKYFNANINTGLYFTYALAVDYILRLF 368


>gi|6324370|ref|NP_014439.1| Coq2p [Saccharomyces cerevisiae S288c]
 gi|416820|sp|P32378|COQ2_YEAST RecName: Full=4-hydroxybenzoate polyprenyltransferase,
           mitochondrial; AltName:
           Full=Para-hydroxybenzoate--polyprenyltransferase;
           Short=PHB:polyprenyltransferase; Flags: Precursor
 gi|171254|gb|AAA34507.1| p-hydroxybenzoate:polyprenyl transferase [Saccharomyces cerevisiae]
 gi|1302547|emb|CAA96321.1| COQ2 [Saccharomyces cerevisiae]
 gi|285814689|tpg|DAA10583.1| TPA: Coq2p [Saccharomyces cerevisiae S288c]
          Length = 372

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 138/296 (46%), Gaps = 14/296 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L  LPC WS ++ A  + +   L  S     L I+ VGA+V RGA
Sbjct: 82  PYAELMRLEKPVGTWLLYLPCSWSILMGA--MMQGATL--SATAGMLGIFGVGALVMRGA 137

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT ND +D  +D +V+R+  RP+ SG+ +  +ALVF   Q L+   +L         +G
Sbjct: 138 GCTINDFLDRKLDQRVIRSVERPIASGRVSPRRALVFLGAQTLVGMGVLSLLPAQCWWLG 197

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTIFWVV 199
            A L I   YP  KRF   PQ  L   F  G  +G+ A+    SWP    L + +  W +
Sbjct: 198 LASLPIVFTYPLFKRFTYYPQAALSACFNWGALLGFPAMGV-MSWPTMIPLYLSSYLWCM 256

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA----FCLLTVNF 255
            +DT+YAHQDKK D   G+ STA  +  +TK  +  +    +    VA      L    F
Sbjct: 257 TYDTIYAHQDKKFDIKAGIKSTALAWGPRTKSIMKAMSASQIALLAVAGLNSGLLWGPGF 316

Query: 256 FAWIGLLI-ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
              +G+    LF  IK++   D+   K C  +F++    G+     L +   L  F
Sbjct: 317 IGGLGVFAYRLFSMIKKV---DLDNPKNCWKYFNANINTGLYFTYALAVDYILRLF 369


>gi|66048255|ref|YP_238096.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           syringae B728a]
 gi|75500024|sp|Q4ZLB4|UBIA_PSEU2 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|63258962|gb|AAY40058.1| 4-hydroxybenzoate polyprenyl transferase, proteobacterial
           [Pseudomonas syringae pv. syringae B728a]
 gi|330970219|gb|EGH70285.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 296

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 121/243 (49%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +A       G     T+     I+++G  + R A 
Sbjct: 19  FIQLTRIDKPIGVYLLLWPTLWAVWIAG-----KGAPSLQTVC----IFVLGVFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +ALV   +   +SFVL+L  N   I + F
Sbjct: 70  CVINDFADRKVDGHVKRTEQRPLVSGKVSPREALVLFAVLVGLSFVLVLFTNAATIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAASYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGELPAAAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L G+ + C M+A     +    +IGL
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILTLQGLALGCLMLAGARFELGACFYIGL 249

Query: 262 LIA 264
           L A
Sbjct: 250 LAA 252


>gi|121609288|ref|YP_997095.1| 4-hydroxybenzoate polyprenyl transferase [Verminephrobacter
           eiseniae EF01-2]
 gi|189037009|sp|A1WKC0|UBIA_VEREI RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|121553928|gb|ABM58077.1| 4-hydroxybenzoate octaprenyltransferase [Verminephrobacter eiseniae
           EF01-2]
          Length = 295

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 111/206 (53%), Gaps = 9/206 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S ++ Y+ L RW+   GW    L CLW T L+A  +   G  GW      L ++++G  +
Sbjct: 7   SRLSLYLDLIRWNRPAGW----LVCLWPT-LSALWVAADGFPGWH----LLLVFVLGTCI 57

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  ND+ D D D  V RT  RP+ +G     +AL    +  L++F L+L  N   
Sbjct: 58  MRSAGCCVNDVADRDFDRHVKRTAQRPVTTGAVGVKEALAVGAVLALLAFGLVLSTNAAT 117

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I      L +++ YP++KR +  PQ VLGI F  G+ + + A+       A++L +GT+F
Sbjct: 118 IAWSVPALLVAIAYPYAKRLVSMPQTVLGIAFNFGIVLAFAAVQGRVPAVAWWLWLGTMF 177

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTA 222
           WV+ +DT YA  D+ DD  IG+ ++A
Sbjct: 178 WVLAYDTEYAMVDRDDDLKIGIKTSA 203


>gi|229593401|ref|YP_002875520.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas fluorescens
           SBW25]
 gi|259550862|sp|C3K4C4|UBIA_PSEFS RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|229365267|emb|CAY53593.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas fluorescens
           SBW25]
          Length = 296

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/243 (33%), Positives = 122/243 (50%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           +V L R     G +L + P LW+  +A            S     + I+++G ++TR   
Sbjct: 19  FVQLTRMDKPIGIYLLLWPTLWALWIAGKG---------SPSLINIVIFVLGVVLTRAGG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +ALVF  +   ISF+L+L  N   I +  
Sbjct: 70  CVINDWADRKVDGHVKRTEQRPLVSGKISSKEALVFFAVLMGISFLLVLLTNATTILLSL 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAASYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGDLPATAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L G+ ++C ++A     +  +  +GL
Sbjct: 190 DTYYAMTDRDDDLKIGVKSTAILFGDADRVIILTLQGLSLVCLLLAGARFELGGWFHLGL 249

Query: 262 LIA 264
           L A
Sbjct: 250 LAA 252


>gi|151944570|gb|EDN62848.1| para-hydroxybenzoate: polyprenyl diphosphate transferase
           [Saccharomyces cerevisiae YJM789]
          Length = 371

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 138/296 (46%), Gaps = 14/296 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L  LPC WS ++ A  + +   L  S     L I+ VGA+V RGA
Sbjct: 81  PYAELMRLEKPVGTWLLYLPCSWSILMGA--MMQGATL--SATAGMLGIFGVGALVMRGA 136

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT ND +D  +D +V+R+  RP+ SG+ +  +ALVF   Q L+   +L         +G
Sbjct: 137 GCTINDFLDRKLDQRVIRSVERPIASGRVSPRRALVFLGAQTLVGMGVLSLLPAQCWWLG 196

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTIFWVV 199
            A L I   YP  KRF   PQ  L   F  G  +G+ A+    SWP    L + +  W +
Sbjct: 197 LASLPIVFTYPLFKRFTYYPQAALSACFNWGALLGFPAMGV-MSWPTMIPLYLSSYLWCM 255

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA----FCLLTVNF 255
            +DT+YAHQDKK D   G+ STA  +  +TK  +  +    +    VA      L    F
Sbjct: 256 TYDTIYAHQDKKFDIKAGIKSTALAWGPRTKSIMKAMSASQIALLAVAGLNSGLLWGPGF 315

Query: 256 FAWIGLLI-ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
              +G+    LF  IK++   D+   K C  +F++    G+     L +   L  F
Sbjct: 316 IGGLGVFAYRLFSMIKKV---DLDNPKNCWKYFNANINTGLYFTYALAVDYILRLF 368


>gi|261341544|ref|ZP_05969402.1| 4-hydroxybenzoate polyprenyl transferase [Enterobacter cancerogenus
           ATCC 35316]
 gi|288316343|gb|EFC55281.1| 4-hydroxybenzoate polyprenyl transferase [Enterobacter cancerogenus
           ATCC 35316]
          Length = 289

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 94/286 (32%), Positives = 140/286 (48%), Gaps = 15/286 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  +A   L            W L +++ G  + R A 
Sbjct: 13  YHRLMRTDKPIGALLLLWPTLWALWVATPGL---------PPLWILAVFVAGVWLMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D   D  V RT +RPLPSGQ T  +A    V+   +SF+L+L  N   I +  
Sbjct: 64  CVVNDYADRKFDGHVKRTANRPLPSGQVTEKEARTLFVVLIALSFLLVLTLNTMTILLSV 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++ +YPF KR+   PQVVLG  F   + + + A+  S     + + +  I W V +
Sbjct: 124 AALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWAVAY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLT-VNFFAWIG 260
           DT YA  D+ DD  IG+ STA LF    KL + I+  + V+  MVA   L  +N+  +  
Sbjct: 184 DTQYAMVDRDDDLKIGIKSTAILFGRHDKLIIGIMQ-VAVVALMVAIGRLNGLNWEFYWS 242

Query: 261 LLIA--LFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           +L+A  LF   +++IA      + C   F +   VG+++ I L +S
Sbjct: 243 VLVAGLLFAYQQKLIA--KREREACFKAFLNNNYVGLVLFIGLAMS 286


>gi|307547005|ref|YP_003899484.1| 4-hydroxybenzoate octaprenyltransferase [Halomonas elongata DSM
           2581]
 gi|307219029|emb|CBV44299.1| 4-hydroxybenzoate octaprenyltransferase [Halomonas elongata DSM
           2581]
          Length = 302

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 132/261 (50%), Gaps = 15/261 (5%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAY--PLRRAGVLGWSTIFWYLFIYIVGA 74
           + +  +++L R     G  L + P LW+  +AA   P R+            + +++VG 
Sbjct: 17  ARLPDFLHLTRLDRPIGTWLLMWPTLWALWMAAQGVPERK-----------IVLVFVVGV 65

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
            + R A C  ND  D   D  V RTR+RPL +G+ +  +A    V+  L++F L+   NP
Sbjct: 66  YLMRAAGCVVNDYADRHFDGHVKRTRNRPLATGRISEREAKGLFVILVLLAFALVWLTNP 125

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT 194
           F + + F  +F++ +YPF KR+   PQV LG  F+ G+ + +GA+       A+ L    
Sbjct: 126 FTVMLSFGGVFLAFIYPFMKRYTHLPQVFLGAAFSWGIPMAFGAVLGYIPAEAWLLLAAN 185

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
           + W V +DT YA  D+ DD  IG+ STA LF    KL + +L  + +         L + 
Sbjct: 186 VAWTVAYDTEYAMVDRDDDLKIGIKSTAVLFGRADKLMIGLLQLVTLALLAWVGRSLGLG 245

Query: 255 FFAWIGL--LIALFLTIKRII 273
            F W+GL  + A F+  +R+I
Sbjct: 246 GFFWLGLAAMAATFVHQQRLI 266


>gi|157373609|ref|YP_001472209.1| 4-hydroxybenzoate octaprenyltransferase [Shewanella sediminis
           HAW-EB3]
 gi|189037007|sp|A8FQF8|UBIA_SHESH RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|157315983|gb|ABV35081.1| 4-hydroxybenzoate polyprenyl transferase [Shewanella sediminis
           HAW-EB3]
          Length = 286

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 126/244 (51%), Gaps = 15/244 (6%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ LAR     G  L + PCL + +LAA         G       L I+I G +V R   
Sbjct: 10  YLRLARMDRPIGTLLLLWPCLMALLLAA---------GGMPDLKVLTIFIFGVVVMRACG 60

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D D+D+ V RT+SRPL SG+ T  +AL+   +  L +F L+L  NP V+ +  
Sbjct: 61  CIINDYADRDLDAHVDRTKSRPLASGEVTGREALILFAVMGLFAFGLVLMLNPLVVKLSV 120

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + ++++YPF+KRF   PQ+ LG+ ++  + + + A        A++L      W V +
Sbjct: 121 VGIILTIIYPFTKRFTNMPQMFLGVVWSWSIPMAYAAQTGEVPAEAWWLFAANWCWTVAY 180

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT+YA  D++DD  +G+ STA LF    +     + G+F L  +   C +T  + A  GL
Sbjct: 181 DTMYAMVDREDDLKVGIKSTAILFGKYDRQ----IIGLFQLAALA--CFITAGWAADRGL 234

Query: 262 LIAL 265
           +  L
Sbjct: 235 VYGL 238


>gi|289620208|emb|CBI53066.1| unnamed protein product [Sordaria macrospora]
          Length = 434

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 85/219 (38%), Positives = 114/219 (52%), Gaps = 13/219 (5%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  LAR    TG +    PCL+ST+LAA PL    +   + +     ++  GAI+ RGA
Sbjct: 120 PYAELARLDKPTGSYYLFFPCLFSTLLAA-PLVPGAIASPAAVVGTSLLFFSGAIIMRGA 178

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C  NDL D ++D  V RTR RP+     T FQ LVF   Q L    +LLQF PF  C  
Sbjct: 179 GCAINDLWDRNLDPHVTRTRLRPIARRAITPFQGLVFTGSQLLAGLAVLLQF-PFG-CFW 236

Query: 141 FA---LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL------HASFSWPAFFLC 191
           +A   LLF++  YP +KR    PQ +LG+ F+ G  +G+ AL      +++    A  L 
Sbjct: 237 YATPSLLFVA-CYPLAKRVTYYPQFMLGLTFSWGAIMGFPALGVDLLANSAALTAAGCLY 295

Query: 192 IGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
              I W V +D +YAH D KDD   G+ S A     +TK
Sbjct: 296 TSNIAWTVLYDMIYAHMDIKDDAKAGIKSIALKHDKETK 334


>gi|238754682|ref|ZP_04616035.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia ruckeri ATCC
           29473]
 gi|238707141|gb|EEP99505.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia ruckeri ATCC
           29473]
          Length = 272

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 126/240 (52%), Gaps = 4/240 (1%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L ++++G  + R A C  ND  D  ID  V RT SRPLPSG  +  ++ +   +  LISF
Sbjct: 33  LIVFVLGVFMMRAAGCVINDFADRKIDGHVKRTASRPLPSGIISEKESKILFAVLVLISF 92

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
            L+L  N   I +  A L ++ +YPF KR    PQVVLG  F   + +G+ A+  S    
Sbjct: 93  GLVLTLNSMTIWLSLAGLALAWVYPFMKRVTHLPQVVLGAAFGWSIPMGFAAVSESLPVV 152

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFM 245
            + L +  I W V +DT+YA  D+ DD  IGV STA LF    +L + +L     VL  +
Sbjct: 153 CWLLLLANICWTVAYDTLYAMVDRDDDLRIGVKSTAILFGQYDRLIVGLLQLATLVLMAV 212

Query: 246 VAFCLLTVNFFAWIGLLI-ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           + + +     F W  LL  ALF+  +++IA      + C   F +   VG+++ + +++S
Sbjct: 213 IGYLMHLGGAFYWSVLLAGALFIHQQKMIA--KRQREPCFQAFLNNNYVGLVLFLGILLS 270


>gi|310765545|gb|ADP10495.1| 4-hydroxybenzoate-octaprenyltransferase [Erwinia sp. Ejp617]
          Length = 288

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 141/292 (48%), Gaps = 15/292 (5%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S  + Y  L R     G  L + P LW+  LA   +    VL          ++++G   
Sbjct: 8   SRFSAYCRLMRIDKPIGSLLLLWPTLWALWLAGMQVPPLKVLS---------VFVLGVFF 58

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLISFVLLLQFNPF 135
            R A C  ND  D  ID  V RTR RPLPSG  T  +A L+FA L  L+SF L++  N  
Sbjct: 59  MRAAGCVVNDFADRKIDGHVKRTRERPLPSGAVTAREAKLLFAGL-VLVSFALVMTMNSM 117

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTI 195
            I +    L ++ +YPF KR+   PQVVLG  F   + + W A+  S     + L +  I
Sbjct: 118 TIWLSLGGLGLAWMYPFMKRYTHLPQVVLGAAFGWAIPMAWAAVSESVPLSCWLLFLANI 177

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN- 254
            W V +DT YA  D+ DD  IGV STA LF    KL + +L    +L   +    + +N 
Sbjct: 178 CWTVAYDTQYAMVDRDDDVKIGVKSTAILFGRYDKLIIGMLQLATLLLLTLVGWRMGLNG 237

Query: 255 -FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
            F+  +    ALF+  +++IA      + C   F +   VG+L+ I + +S+
Sbjct: 238 VFYGTVLAAGALFIYQQKLIAR--RQRELCFKAFLNNNWVGLLLFIGVALSI 287


>gi|163748668|ref|ZP_02155921.1| 4-hydroxybenzoate polyprenyl transferase [Shewanella benthica KT99]
 gi|161331778|gb|EDQ02582.1| 4-hydroxybenzoate polyprenyl transferase [Shewanella benthica KT99]
          Length = 288

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 80/244 (32%), Positives = 129/244 (52%), Gaps = 15/244 (6%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L+R     G  L + PCL + +LAA  +    VL          I+I+G +V R   
Sbjct: 12  YMRLSRMDRPIGTLLLLWPCLMALILAADGMPDLKVL---------VIFILGVVVMRACG 62

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D ++DS V RT+SRPL SG+ +  +AL+   +  L +F L+L  NP V+ +  
Sbjct: 63  CIINDYADRELDSHVDRTKSRPLASGEISSKEALLLFAVMGLFAFGLVLMLNPLVVQLSV 122

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + ++++YPF+KRF   PQ+ LG+ ++  + + + A   S    A++L      W V +
Sbjct: 123 VGIILTVIYPFTKRFTNMPQMFLGVVWSWSIPMAYAAQTGSVPAEAWWLFFANWCWTVAY 182

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT+YA  D++DD  +G+ STA LF    +     + G+F L  +   C +T  + A  GL
Sbjct: 183 DTMYAMVDREDDLKVGIKSTAILFGQYDRQ----IIGLFQLAALA--CFITAGWAADRGL 236

Query: 262 LIAL 265
           +  L
Sbjct: 237 VYGL 240


>gi|253995562|ref|YP_003047626.1| 4-hydroxybenzoate polyprenyl transferase [Methylotenera mobilis
           JLW8]
 gi|253982241|gb|ACT47099.1| 4-hydroxybenzoate polyprenyl transferase [Methylotenera mobilis
           JLW8]
          Length = 289

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 126/248 (50%), Gaps = 9/248 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
             I  Y  L R     G  L + P LW+ ++AA     AG   W  +     I++ G ++
Sbjct: 8   KKINSYERLMRLDKPIGILLLLWPTLWALLIAA-----AGKPDWIMVL----IFVTGTVL 58

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  ND+ D   D  V RT+ RPLP+ + T+ +A + A+   +I+F L+   N   
Sbjct: 59  MRSAGCVMNDIADSQYDGMVERTQFRPLPNKEVTKKEAYLLALALSVIAFGLVCLLNTLT 118

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I +    LF+++ YP +KRF + PQ  LG+ F  G+ + + A+  +    A+ L    +F
Sbjct: 119 IQLSVLALFLAMTYPLTKRFFVMPQAYLGVAFGFGIPMAFAAVTDAVPAVAWLLLCANVF 178

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
           W + +DT YA  D++DD  IG+ S+A  F       + + YG+ +L   VA  LL ++  
Sbjct: 179 WAIAYDTEYAMVDREDDLKIGIKSSAITFGRFDVGAIMLCYGMTLLLLGVAGYLLELSCV 238

Query: 257 AWIGLLIA 264
            + GL +A
Sbjct: 239 YFFGLGLA 246


>gi|259909950|ref|YP_002650306.1| 4-hydroxybenzoate octaprenyltransferase [Erwinia pyrifoliae Ep1/96]
 gi|224965572|emb|CAX57104.1| 4-hydroxybenzoate octaprenyltransferase [Erwinia pyrifoliae Ep1/96]
          Length = 282

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 141/292 (48%), Gaps = 15/292 (5%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S  + Y  L R     G  L + P LW+  LA   +    VL          ++++G   
Sbjct: 2   SRFSAYCRLMRIDKPIGSLLLLWPTLWALWLAGMQVPPLKVLS---------VFVLGVFF 52

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLISFVLLLQFNPF 135
            R A C  ND  D  ID  V RTR RPLPSG  T  +A L+FA L  L+SF L++  N  
Sbjct: 53  MRAAGCVVNDFADRKIDGHVKRTRERPLPSGAVTAREAKLLFAGL-VLVSFALVMTMNSM 111

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTI 195
            I +    L ++ +YPF KR+   PQVVLG  F   + + W A+  S     + L +  I
Sbjct: 112 TIWLSLGGLGLAWMYPFMKRYTHLPQVVLGAAFGWAIPMAWAAVSESVPLSCWLLFLANI 171

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN- 254
            W V +DT YA  D+ DD  IGV STA LF    KL + +L    +L   +    + +N 
Sbjct: 172 CWTVAYDTQYAMVDRDDDVKIGVKSTAILFGRYDKLIIGMLQLATLLLLTLVGWRMGLNG 231

Query: 255 -FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
            F+  +    ALF+  +++IA      + C   F +   VG+L+ I + +S+
Sbjct: 232 VFYGTVLAAGALFIYQQKLIAR--RQRELCFKAFLNNNWVGLLLFIGVALSI 281


>gi|283480047|emb|CAY75963.1| 4-hydroxybenzoate-octaprenyltransferase [Erwinia pyrifoliae DSM
           12163]
          Length = 298

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 141/292 (48%), Gaps = 15/292 (5%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S  + Y  L R     G  L + P LW+  LA   +    VL          ++++G   
Sbjct: 18  SRFSAYCRLMRIDKPIGSLLLLWPTLWALWLAGMQVPPLKVLS---------VFVLGVFF 68

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLISFVLLLQFNPF 135
            R A C  ND  D  ID  V RTR RPLPSG  T  +A L+FA L  L+SF L++  N  
Sbjct: 69  MRAAGCVVNDFADRKIDGHVKRTRERPLPSGAVTAREAKLLFAGL-VLVSFALVMTMNSM 127

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTI 195
            I +    L ++ +YPF KR+   PQVVLG  F   + + W A+  S     + L +  I
Sbjct: 128 TIWLSLGGLGLAWMYPFMKRYTHLPQVVLGAAFGWAIPMAWAAVSESVPLSCWLLFLANI 187

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN- 254
            W V +DT YA  D+ DD  IGV STA LF    KL + +L    +L   +    + +N 
Sbjct: 188 CWTVAYDTQYAMVDRDDDVKIGVKSTAILFGRYDKLIIGMLQLATLLLLTLVGWRMGLNG 247

Query: 255 -FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
            F+  +    ALF+  +++IA      + C   F +   VG+L+ I + +S+
Sbjct: 248 VFYGTVLAAGALFIYQQKLIAR--RQRELCFKAFLNNNWVGLLLFIGVALSI 297


>gi|330986908|gb|EGH85011.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 296

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 119/243 (48%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +A       G     T+F    I++VG  + R A 
Sbjct: 19  FIQLTRIDKPIGIYLLLWPTLWAVWIAG-----KGSPSLKTVF----IFVVGVFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D   D  V RT  RPL SG+ +  +AL    +   +SFVL+L  N   I + F
Sbjct: 70  CVINDFADRKGDGHVKRTEQRPLVSGKVSSREALALFAVLVGLSFVLVLFTNATTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAACYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGDLPAAAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L G+ + C M+A     +    + GL
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILTLQGLALGCLMLAGARFELGACFYTGL 249

Query: 262 LIA 264
           L A
Sbjct: 250 LAA 252


>gi|56476704|ref|YP_158293.1| 4-hydroxybenzoate octaprenyltransferase [Aromatoleum aromaticum
           EbN1]
 gi|56312747|emb|CAI07392.1| UbiA prenyltransferase [Aromatoleum aromaticum EbN1]
          Length = 295

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 124/240 (51%), Gaps = 16/240 (6%)

Query: 13  CIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIV 72
             + S +  Y+ L R     G  L + P LW+  LAA         G+  +   + I+ +
Sbjct: 6   ATLSSRLPLYLRLMRLDKPIGILLLMWPTLWALWLAAD--------GFPPLH-LIVIFAL 56

Query: 73  GAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQF 132
           G ++ R A C  ND  D D D  V RTR+RPL +G  T  +AL+ A    L+SFVL+L  
Sbjct: 57  GTVLMRSAGCVINDYADRDFDGHVERTRTRPLTTGAVTVREALLLAAGLSLVSFVLILPL 116

Query: 133 NPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI 192
           +P V  +    LF++  YP++KRF+  PQ  LGI F  G+ +G+ A+       A+ L +
Sbjct: 117 DPLVRWLSLPALFLAASYPYTKRFLAIPQAYLGIAFGFGIPMGFAAVQGEVPAIAWLLLL 176

Query: 193 GTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLT 252
             IFW V +DT YA  D+ DD  IG+ ++A  F        F +  + +LC+ VAF L+ 
Sbjct: 177 ANIFWAVAYDTEYAMVDRPDDLKIGIKTSAITFGR------FDVAAV-MLCYAVAFGLIA 229


>gi|311109488|ref|YP_003982341.1| 4-hydroxybenzoate polyprenyl transferase [Achromobacter
           xylosoxidans A8]
 gi|310764177|gb|ADP19626.1| 4-hydroxybenzoate polyprenyl transferase [Achromobacter
           xylosoxidans A8]
          Length = 327

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 86/248 (34%), Positives = 117/248 (47%), Gaps = 27/248 (10%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAA---YPLRRAGVLGWSTIFWYLFIYIVGAIVT 77
           PY  L R     G  L +LP + + V AA     LRR            L ++ +GA++ 
Sbjct: 49  PYARLCRLDRPIGTWLTLLPAIAALVQAAGGLPDLRR------------LIVFSLGALLM 96

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           RG  CT ND+ D + D  V RTR RPL SGQ T   A+ F + Q L+   LL   N    
Sbjct: 97  RGIGCTVNDMCDRNFDKHVERTRFRPLTSGQLTMKNAVWFLIGQLLVCGSLLFFLNEMSR 156

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFW 197
            +  A+L    +YP  KR    PQVVLGI F  G+ + W          A  +  G + W
Sbjct: 157 WLAVAVLPFVFIYPLCKRVTYWPQVVLGICFNWGMLMAWSDTQNHVPLAAIAMWAGAVLW 216

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFA 257
            V +D++YA+ D +DD  +G++STA  F  Q KLW+              F L T+  +A
Sbjct: 217 QVGYDSIYAYVDVRDDRSLGLHSTAMRFGDQGKLWIG------------GFYLATIALWA 264

Query: 258 WIGLLIAL 265
           W G  I L
Sbjct: 265 WGGYAIGL 272


>gi|88607763|ref|YP_504922.1| prenyltransferase [Anaplasma phagocytophilum HZ]
 gi|88598826|gb|ABD44296.1| 4-hydroxybenzoate octaprenyltransferase [Anaplasma phagocytophilum
           HZ]
          Length = 292

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 81/221 (36%), Positives = 111/221 (50%), Gaps = 8/221 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
            A+ PY  L R HS     LA  P   S VLA+  L       +S +  ++ + I GA+V
Sbjct: 10  GALVPYSQLIRLHSCEISLLATFPTCASIVLASNSL-------YSVLKLFVLVAI-GALV 61

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  ND+ D +ID  V RT+SRP+  G+    + L    +   I+ V+LL  N   
Sbjct: 62  VRSAGCIINDIFDRNIDIHVHRTKSRPIACGRLKVREGLCALAVLLCIAGVILLFTNKLS 121

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           + +        +LYP  KRF   PQ VLGI +  G+ +G         + +  L IG IF
Sbjct: 122 LYLSIICFCGVVLYPLMKRFFSYPQFVLGIVWNFGILIGSAMAANEVKFGSILLYIGCIF 181

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY 237
           W   FDT+YAHQDK DD  +G+ STA  F   T L++  LY
Sbjct: 182 WTTAFDTIYAHQDKVDDARLGLGSTALKFGDNTGLYVKRLY 222


>gi|118574188|sp|Q5P5M0|UBIA_AZOSE RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
          Length = 294

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 124/240 (51%), Gaps = 16/240 (6%)

Query: 13  CIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIV 72
             + S +  Y+ L R     G  L + P LW+  LAA         G+  +   + I+ +
Sbjct: 5   ATLSSRLPLYLRLMRLDKPIGILLLMWPTLWALWLAAD--------GFPPLH-LIVIFAL 55

Query: 73  GAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQF 132
           G ++ R A C  ND  D D D  V RTR+RPL +G  T  +AL+ A    L+SFVL+L  
Sbjct: 56  GTVLMRSAGCVINDYADRDFDGHVERTRTRPLTTGAVTVREALLLAAGLSLVSFVLILPL 115

Query: 133 NPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI 192
           +P V  +    LF++  YP++KRF+  PQ  LGI F  G+ +G+ A+       A+ L +
Sbjct: 116 DPLVRWLSLPALFLAASYPYTKRFLAIPQAYLGIAFGFGIPMGFAAVQGEVPAIAWLLLL 175

Query: 193 GTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLT 252
             IFW V +DT YA  D+ DD  IG+ ++A  F        F +  + +LC+ VAF L+ 
Sbjct: 176 ANIFWAVAYDTEYAMVDRPDDLKIGIKTSAITFGR------FDVAAV-MLCYAVAFGLIA 228


>gi|152998394|ref|YP_001343229.1| 4-hydroxybenzoate polyprenyl transferase [Marinomonas sp. MWYL1]
 gi|189036993|sp|A6W3L5|UBIA_MARMS RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|150839318|gb|ABR73294.1| 4-hydroxybenzoate polyprenyl transferase [Marinomonas sp. MWYL1]
          Length = 284

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 93/304 (30%), Positives = 144/304 (47%), Gaps = 34/304 (11%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           + +  Y  L R++   G  L + P LW+  LAA      G+  W  +     I+I+G   
Sbjct: 2   NKLKDYAELTRFNRPIGSFLLMWPTLWALWLAA-----DGMPQWHLVI----IFILGVFS 52

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  ND  D  +D  V RT++RPLPSG+ +  +AL+      ++SF+L+L  +   
Sbjct: 53  MRSAGCVINDYADRKVDGFVDRTKNRPLPSGRVSEKEALMLFCALSILSFILVLFTDLRT 112

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF-FLCIGTI 195
           I + F  L ++ LYPF KR+   PQ+ LG+ F+  + + + A     + P    L +   
Sbjct: 113 ILLSFVGLGLAALYPFMKRYTHLPQLFLGLAFSWAIPMAYSAQGGDLTDPKLWMLFVANC 172

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
           FW + +DT YA  D+ DD  IG+ STA            IL+G + L  ++    LT++ 
Sbjct: 173 FWTIAYDTYYAMTDRPDDLKIGIKSTA------------ILFGQYDLFVIICLQGLTLSL 220

Query: 256 FAWIGLLIAL----FLTIKRIIALDISCSKQ--------CCSFFHSAGVVGILILICLII 303
             WIGLL  L    F+++   + L     KQ        C   F     VG  + I L+ 
Sbjct: 221 LTWIGLLAGLHWLYFVSLIVCVGLFYQQFKQAKERDRQACFRSFLDNNRVGYCVFIGLVA 280

Query: 304 SLFL 307
           S F+
Sbjct: 281 SYFM 284


>gi|255722746|ref|XP_002546307.1| para-hydroxybenzoate--polyprenyltransferase, mitochondrial
           precursor [Candida tropicalis MYA-3404]
 gi|240130824|gb|EER30386.1| para-hydroxybenzoate--polyprenyltransferase, mitochondrial
           precursor [Candida tropicalis MYA-3404]
          Length = 368

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 140/273 (51%), Gaps = 11/273 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY+ L R     G  L +LPC W+  +A+Y +  A  L W T    + ++ +GA+V RGA
Sbjct: 79  PYLELMRLEKPVGTWLLLLPCYWAITMASYSI--AAPL-WVTAK-AIGLFSIGALVMRGA 134

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT ND+ D ++D+QV RT  RP+ SG+ +  QA+ +  +Q      +LL        +G
Sbjct: 135 GCTINDIWDRNLDNQVARTMERPITSGRVSVPQAVAWLGVQCFAGLAVLLSLPFECFYLG 194

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFS-WPAFFLCIGTIFWVV 199
              L     YP  KRF   PQ +L I F+ G  +G+ A+ A  + W A  L I    W +
Sbjct: 195 ALSLPFVAAYPLFKRFTYYPQAMLSICFSWGCLLGFPAVGAPLNLWVAVPLFISNWIWCL 254

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC---FMVAFCLLTVNFF 256
            +DT+YAHQDK  D+  G+ STA  +  +TK    IL G+ V     + VA  + ++   
Sbjct: 255 TYDTIYAHQDKNFDKFAGIKSTALAWGDKTKP---ILKGLTVAQGGFYAVAGIMNSMGPG 311

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHS 289
            +I    A+     +++ +D++  K C S F S
Sbjct: 312 FYIAGAYAIARIYNQVLKVDLNNEKSCWSAFTS 344


>gi|113474132|ref|YP_720193.1| 4-hydroxybenzoate polyprenyltransferase [Trichodesmium erythraeum
           IMS101]
 gi|110165180|gb|ABG49720.1| 4-hydroxybenzoate octaprenyltransferase [Trichodesmium erythraeum
           IMS101]
          Length = 291

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/210 (33%), Positives = 107/210 (50%), Gaps = 9/210 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S +   + L RW    G  + ++P LW+  LA + +    ++G         + +VG + 
Sbjct: 9   STLMKVIRLLRWDKPAGRFILMIPALWAVFLATHAMPPIPLVG---------VIVVGTLA 59

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
           T  A C  NDL D DIDS+V RTR RPL S   T    ++  ++ F  + V+ L  NP  
Sbjct: 60  TSAAGCVVNDLWDRDIDSEVERTRDRPLTSRALTIQTGIIIVIIAFACAGVIALYLNPLS 119

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
             +  A + + + YP +KRF   PQ+VL I +   V + W A  A      + L   TI 
Sbjct: 120 FWLSVAAVPVIICYPLAKRFFPVPQLVLSIAWGFAVLISWSAAVAKLDSATWILWGATIV 179

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFS 226
           W + FDTVYA  D++DD+ +G+NS+A  F 
Sbjct: 180 WTLGFDTVYAMSDREDDQRLGINSSALFFG 209


>gi|88657627|ref|YP_507259.1| prenyltransferase [Ehrlichia chaffeensis str. Arkansas]
 gi|88599084|gb|ABD44553.1| 4-hydroxybenzoate octaprenyltransferase [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 291

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 91/288 (31%), Positives = 144/288 (50%), Gaps = 10/288 (3%)

Query: 10  VRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFI 69
           ++D I  S    Y  L R HS     L + P L S  L ++ + RA          Y+F+
Sbjct: 4   IKDII--SNFRKYHLLLRLHSVEIILLLIFPSLASIALVSHSVLRAC--------GYMFL 53

Query: 70  YIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLL 129
             +GA + R A C  ND+ D  IDS+V RT++RPL +   + FQAL    +  L + VLL
Sbjct: 54  CSIGAFIMRPAGCIINDIFDRKIDSEVKRTQNRPLANNSLSVFQALKILAILLLCACVLL 113

Query: 130 LQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF 189
           +  N + I +    + + +LYP +KR+   PQ++LGI F  G+ +G        +     
Sbjct: 114 VLTNMYTIKIAIVSMVLIVLYPLAKRYFAWPQLLLGIVFNTGILMGCTMTVGHLTLSCVL 173

Query: 190 LCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFC 249
           L IG IFW V +DT+YA QDK+ D  +G+ STA  F    +LW+  LY I V  ++ A  
Sbjct: 174 LYIGCIFWTVGYDTIYAAQDKEYDIKLGLQSTAIKFGNDIRLWIGRLYMITVTMWLSAGI 233

Query: 250 LLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
           +  ++   ++ +LI   +   +    D    ++C   F     VG+++
Sbjct: 234 IAVLHPIFYLAILIIAAIFYYQYKKSDFDNPEKCMYMFKVNIYVGLIL 281


>gi|326315386|ref|YP_004233058.1| 4-hydroxybenzoate polyprenyl transferase [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323372222|gb|ADX44491.1| 4-hydroxybenzoate polyprenyl transferase [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 295

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 112/206 (54%), Gaps = 9/206 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S +A Y+ L RW    GW L + P L +  +AA      G  GW      L ++I+G I+
Sbjct: 13  SRLALYLDLIRWSRPAGWLLLLWPTLSALWIAA-----GGFPGWH----LLAVFILGTIL 63

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  ND+ D D D  V RT  RP+ SG  +  +AL    +  L+SF L+L  N   
Sbjct: 64  MRSAGCCVNDVADRDFDRHVKRTAQRPVTSGAVSVREALAVGAVLALVSFGLVLTTNAAT 123

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           +      L +++ YPF+KRF+  PQ VLG+ F+ G+ + + A+  S +  A +L +G + 
Sbjct: 124 VAWSLPALAVTIAYPFAKRFVSMPQAVLGVAFSMGIPMAFTAVGGSVTPLAAWLVLGNLC 183

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTA 222
           WV+ +DT YA  D+ DD  IG+ ++A
Sbjct: 184 WVLAYDTEYAMVDRDDDLKIGMKTSA 209


>gi|75909737|ref|YP_324033.1| 4-hydroxybenzoate polyprenyltransferase [Anabaena variabilis ATCC
           29413]
 gi|75703462|gb|ABA23138.1| 4-hydroxybenzoate octaprenyltransferase [Anabaena variabilis ATCC
           29413]
          Length = 290

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 80/243 (32%), Positives = 117/243 (48%), Gaps = 15/243 (6%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAY---PLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           L RWH   G  + ++P LW+  LAA    PL   GV+            ++G + T  A 
Sbjct: 16  LLRWHKPEGRLILMIPALWAVFLAAAGKPPLPLVGVI------------VLGTLATSAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  NDL D DID +V RTR RPL S   +    +   ++    + +L    NP    +  
Sbjct: 64  CVVNDLWDRDIDPEVERTRDRPLASRTLSIKVGIAVGIISLFCAAILAYYLNPLSFWLSV 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A + + LLYP +KR    PQ+VL I +   V + W A+  + S   + L   T+ W + F
Sbjct: 124 AAVPVILLYPGAKRVFPVPQLVLSIAWGFAVLISWSAVTQNISQATWLLWGATLLWTLGF 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DTVYA  D++DD  IGVNS+A  F     L + I +   ++C       + ++   WI L
Sbjct: 184 DTVYAMSDREDDRRIGVNSSALFFGDYAPLAIGIFFLGTIICLTWLGVAIHLHLAFWITL 243

Query: 262 LIA 264
            IA
Sbjct: 244 GIA 246


>gi|317401505|gb|EFV82136.1| 4-hydroxybenzoate-octaprenyl transferase [Achromobacter
           xylosoxidans C54]
          Length = 308

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 116/245 (47%), Gaps = 21/245 (8%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L +LPC+ + V AA  L              L ++ +GA++ RG 
Sbjct: 30  PYARLCRLDRPIGTWLTLLPCIAALVQAAGGL---------PDLQRLVVFSLGALLMRGI 80

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT ND+ D + D  V RTR RPL SGQ +   A+ F + Q L+   LL   N     + 
Sbjct: 81  GCTVNDMCDRNFDKHVERTRFRPLTSGQLSMRNAVWFLIGQLLVCGSLLFFLNGMSRWLA 140

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A+L    +YP  KR    PQVVLGI F  G+ + W          A  +  G + W V 
Sbjct: 141 VAVLPFVFIYPLCKRVTYWPQVVLGICFNWGMLMAWSDTQNHVPLAAIAMWFGAVLWQVG 200

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +D++YA+ D +DD  +G++STA  F  Q KLW+              F L TV  +AW G
Sbjct: 201 YDSIYAYVDVRDDRSLGLHSTAMRFGDQGKLWIG------------GFYLATVILWAWGG 248

Query: 261 LLIAL 265
             I +
Sbjct: 249 HAIGM 253


>gi|221127186|ref|XP_002154697.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
          Length = 391

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 140/291 (48%), Gaps = 8/291 (2%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           I PY+ L R+  + G  L   P  WS  +AA        +G       L ++ +G+ + R
Sbjct: 87  IKPYLDLIRFQRTIGTWLLFFPGSWSIAMAA-------PVGMFPDAKLLLLFGIGSFLMR 139

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
            + C  ND+ D + D +V RT SRPL +G  ++ +AL+F       S  +LL  N + I 
Sbjct: 140 SSGCIINDMWDKEFDKKVTRTASRPLATGALSQTEALIFLSGMLSCSLCVLLTLNWYSIF 199

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA-FFLCIGTIFW 197
           +G   + + + YP  KR    PQ+VLG     G  +GW A+    +W     L +  I W
Sbjct: 200 LGAFSMSLVVTYPLFKRVTYWPQLVLGATLNWGALLGWSAVQGECNWIVCLPLYMAGISW 259

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFA 257
            + +DT+YAHQDK DD LIGV STA LF   TK  L +     V    V+      ++  
Sbjct: 260 TLLYDTIYAHQDKVDDALIGVKSTALLFGDNTKKMLSLFSACMVTGLFVSGYSSEQSWPY 319

Query: 258 WIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLD 308
           ++ LL+       +I  ++++    C   F S   +G+++   +++S  L 
Sbjct: 320 YLSLLLVGLHLSWQIQTVNLANPADCSGKFTSNKNIGLILFFGILLSNLLK 370


>gi|330961381|gb|EGH61641.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 296

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 109/214 (50%), Gaps = 9/214 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +A       G     T+F    I++VG  + R A 
Sbjct: 19  FIQLTRIDKPIGIYLLLWPTLWAVWIAG-----KGAPSLKTVF----IFVVGVFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +AL+   +   +SFVL+L  NP  I + F
Sbjct: 70  CVINDFADRKVDGHVKRTEQRPLVSGKVSSREALILFAVLVGLSFVLVLFTNPTTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAATYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGELPAAAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFI 235
           DT YA  D+ DD  IGV STA LF    ++ + I
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRVIIII 223


>gi|166363406|ref|YP_001655679.1| 4-hydroxybenzoate polyprenyltransferase [Microcystis aeruginosa
           NIES-843]
 gi|166085779|dbj|BAG00487.1| 4-hydroxybenzoate-octaprenyl transferase [Microcystis aeruginosa
           NIES-843]
          Length = 293

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 118/238 (49%), Gaps = 21/238 (8%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           + L RW    G  + ++P LW+  LAA  +    ++G         + ++G + T  A C
Sbjct: 16  IRLLRWDKPAGRLILMIPALWAVFLAADGVPPLPLIG---------VIVLGTLATSAAGC 66

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFA 142
             NDL D DID QV RTR+RPL +   +    L+ A++ F  + +L L  N    C+  A
Sbjct: 67  VVNDLWDRDIDPQVDRTRNRPLAARALSIKVGLIIALIAFFCAAILALYLNFLSFCLCLA 126

Query: 143 LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFD 202
            + + + YP +KRF   PQ+VL + +   V + W A+  S +   F L    IFW + FD
Sbjct: 127 AVPLIICYPLAKRFFPVPQLVLSLAWGFAVLICWSAVTGSLNSNTFILWGAVIFWTLAFD 186

Query: 203 TVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           T+YA  D++DD  +G+NS+A            I +G +    +  F  LTV   AW G
Sbjct: 187 TIYALSDREDDLKVGINSSA------------IFFGKYAPEAVGVFFALTVGLLAWEG 232


>gi|294084694|ref|YP_003551452.1| 4-hydroxybenzoate-octaprenyl transferase [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664267|gb|ADE39368.1| 4-hydroxybenzoate-octaprenyl transferase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 313

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 138/281 (49%), Gaps = 11/281 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PYVYLAR     GW L +LP  W   +A+    + G+L        + ++++GAI  R A
Sbjct: 30  PYVYLARLDRPIGWWLLLLPAWWVIPVASADSGQMGLL--------MLLFMIGAITMRAA 81

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C  ND+ D DID ++ RT+SRPL SG  +   A +F V   +I   +L+Q  P  I +G
Sbjct: 82  GCVINDMWDRDIDIKIQRTQSRPLASGAISMGMAFIFLVCLGIIGLAVLVQLPPMAIFIG 141

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLC-IGTIFWVV 199
              L +  LYP +KR    PQ VLG+ FA GV +G  A        +F+L   G++ WV 
Sbjct: 142 IGSLPLVALYPLAKRVTWFPQFVLGLTFAWGVPLGVAAATNQAPSLSFWLIYAGSVAWVF 201

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW- 258
            +DT+YA QD  DD   GV S+A          + I Y I +L     F  +T+ F  W 
Sbjct: 202 GYDTIYAVQDMVDDRQSGVKSSALGLGKNLHKGVGIAYAIAILLLSAGFY-MTMGFGLWF 260

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILI 299
           +G+ +      +++  LD          F S    G+++ I
Sbjct: 261 VGVSLMGLHLAQQLRQLDAGDPAMALRLFKSNRNAGLILTI 301


>gi|159030180|emb|CAO91072.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 293

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 118/238 (49%), Gaps = 21/238 (8%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           + L RW    G  + ++P LW+  LAA  +    ++G         + I+G + T  A C
Sbjct: 16  IRLLRWDKPAGRLILMVPALWAVFLAADGVPPLPLIG---------VIILGTLATSAAGC 66

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFA 142
             NDL D DID QV RTR+RPL +   +    L+ A++ F  + +L L  N    C+  A
Sbjct: 67  VVNDLWDRDIDPQVDRTRNRPLAARALSIKVGLIIALIAFFCAAILALYLNFLSFCLCVA 126

Query: 143 LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFD 202
            + + + YP +KRF   PQ+VL + +   V + W A+  S +   F L    IFW + FD
Sbjct: 127 AVPLIICYPLAKRFFPVPQLVLSLAWGFAVLICWSAVTGSLNSNTFILWGAVIFWTLAFD 186

Query: 203 TVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           T+YA  D++DD  +G+NS+A            I +G +    +  F  LTV   AW G
Sbjct: 187 TIYALSDREDDLKVGINSSA------------IFFGKYAPEAVGVFFALTVGLLAWEG 232


>gi|73667198|ref|YP_303214.1| prenyltransferase [Ehrlichia canis str. Jake]
 gi|72394339|gb|AAZ68616.1| 4-hydroxybenzoate octaprenyltransferase [Ehrlichia canis str. Jake]
          Length = 295

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 85/279 (30%), Positives = 141/279 (50%), Gaps = 8/279 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
            Y+ L   H    + LA+ P L S VL ++ +  A         WY+ + IVG  + + A
Sbjct: 14  KYIELLGLHMVETFFLALFPGLVSVVLVSHDVLSAC--------WYMLLCIVGTSIVKPA 65

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C  N + D +ID++V RT++RPL     T  QAL   V+  L S  LL+  N + + + 
Sbjct: 66  GCVINCICDREIDAKVKRTKNRPLADKSLTVVQALKVLVVLLLCSCGLLVFTNMYTVKLS 125

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              + + ++YP SKRF   PQ +LG+ F  GV +    +    +     L IG IFW + 
Sbjct: 126 IITMILIVIYPLSKRFFAWPQFLLGLVFNSGVLLVCSMITGRLTLSCILLYIGCIFWTIG 185

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT+YA QD++ D  +G+NSTA  F    +LW+  +Y I V  +M A  +  ++   +I 
Sbjct: 186 YDTIYAAQDRECDAKLGLNSTALRFGNDIRLWIGRVYTITVAMWMSAGVVAMLHPVFYIA 245

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILI 299
           +LI   +   +    D   S++C   F+    +G+++ +
Sbjct: 246 VLIIAVIFYYQYKKSDFDNSEKCMYMFNMNAYIGLVLFV 284


>gi|158336734|ref|YP_001517908.1| prenyltransferase [Acaryochloris marina MBIC11017]
 gi|158306975|gb|ABW28592.1| 4-hydroxybenzoate polyprenyl transferase [Acaryochloris marina
           MBIC11017]
          Length = 295

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 131/287 (45%), Gaps = 11/287 (3%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           + L RW    G  + ++P LW+ VLAA      G++          I I G++ T  A C
Sbjct: 17  IKLLRWDKPEGRLILMIPALWAIVLAAQGKPSLGLV---------TIIITGSLATSAAGC 67

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFA 142
             NDL D +ID QV RTR RPL     T    L  A L F  +F L    NP    +  A
Sbjct: 68  VVNDLWDRNIDPQVQRTRKRPLADRSLTIRVGLAIAFLAFACAFGLSRFLNPLSFGLCVA 127

Query: 143 LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFD 202
            + + + YP +KR    PQ+VL I +   V + W A   + S  A+ L   T+ W + FD
Sbjct: 128 AVPVIICYPLAKRVFPVPQLVLAIAWGFSVLISWSAAVGNLSLGAWLLWAATVLWTLGFD 187

Query: 203 TVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLL 262
           T+YA  D+ DD  +G+NS+A  F    +  +       V+C  +    L ++F  W  L 
Sbjct: 188 TIYAMPDRPDDRRLGINSSALFFGNYAEAAIACFLVATVICLGMLGYALNLHFGYWTSLG 247

Query: 263 IALFLTIKRIIALDIS--CSKQCCSFFHSAGVVGILILICLIISLFL 307
           ++ +L  ++I  L             F     +G+L+L+ +I    L
Sbjct: 248 LSTYLWWRQIYRLRRKNLVPSAYGQLFRQNVWIGLLLLVGMITGSLL 294


>gi|302187090|ref|ZP_07263763.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           syringae 642]
          Length = 296

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 82/243 (33%), Positives = 120/243 (49%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +A       G     T+     I+++G  + R A 
Sbjct: 19  FIQLTRIDKPIGVYLLLWPTLWAVWIAG-----KGAPSLQTVC----IFVLGVFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +ALV   +   +SFVL+L  N   I + F
Sbjct: 70  CVINDFADRKVDGHVKRTEQRPLVSGRVSSREALVLFAVLVGLSFVLVLFTNATTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAASYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGELPAAAWLLYIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L  + + C M+A     +    +IGL
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILTLQALALGCLMLAGARFELGACFYIGL 249

Query: 262 LIA 264
           L A
Sbjct: 250 LAA 252


>gi|226326607|ref|ZP_03802125.1| hypothetical protein PROPEN_00457 [Proteus penneri ATCC 35198]
 gi|225205032|gb|EEG87386.1| hypothetical protein PROPEN_00457 [Proteus penneri ATCC 35198]
          Length = 284

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 91/287 (31%), Positives = 138/287 (48%), Gaps = 13/287 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P  W+  +AA      G   W      L ++ +G    R A 
Sbjct: 9   YSRLMRIDKPIGALLLLWPTYWALWIAA-----KGFPDWHI----LIVFTIGVFSMRAAG 59

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  ID  V RT++RPLPSG  T  ++ +  ++  L+SF L+L  N   I +  
Sbjct: 60  CVINDFADRKIDGSVERTKNRPLPSGAVTEKESKILFIVLVLLSFALVLTLNTMTIWLSV 119

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++  YPF KRF   PQ++LG+ F   + +G+ A+  +     + L +  I W V +
Sbjct: 120 AGLALAWFYPFVKRFSNLPQLILGMAFGWSIPMGFAAVSETLPLVCWLLFLVNIVWSVIY 179

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN-FFAWIG 260
           DT YA  D+ DD  IGV STA LF    K+ + IL  + +   +    LL +   + W  
Sbjct: 180 DTQYAMVDRNDDIKIGVKSTAILFGRYDKIIIGILQLVMLALLVGIGILLNLKGIYYWSL 239

Query: 261 LLI-ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
           LL+ ALF+  +++IA        C   F +   VG ++   ++ S F
Sbjct: 240 LLVTALFIYQQKLIAERERAP--CFQAFMNNNYVGFVLFAGILFSYF 284


>gi|170769490|ref|ZP_02903943.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia albertii
           TW07627]
 gi|170121547|gb|EDS90478.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia albertii
           TW07627]
          Length = 290

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 128/245 (52%), Gaps = 8/245 (3%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
            W L +++ G  + R A C  ND  D   D  V RT +RPLPSG+ +  +A    V+  L
Sbjct: 46  LWILAVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGEVSEKEARTLFVVLVL 105

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           ISF+L+L  N   I +  A L ++ +YPF KR+   PQVVLG  F   + + + A+  S 
Sbjct: 106 ISFLLVLTLNTMTILLSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESV 165

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
               + + +  IFW V +DT YA  D+ DD  IG+ STA LF    KL + IL  I VL 
Sbjct: 166 PLSCWLMFLANIFWAVAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQ-IGVLA 224

Query: 244 FMVAFCLLTVNFFAWIGLLI---ALFLTIKRIIALDISCSKQCC-SFFHSAGVVGILILI 299
            M     L    + + G ++   ALF+  +++IA   +  ++ C   F +   VG+++ +
Sbjct: 225 LMAIIGELNGLGWGYYGSILVAGALFVYQQKLIA---NREREACFKAFMNNNYVGLVLFL 281

Query: 300 CLIIS 304
            L +S
Sbjct: 282 GLAMS 286


>gi|86605727|ref|YP_474490.1| 4-hydroxybenzoate polyprenyltransferase [Synechococcus sp.
           JA-3-3Ab]
 gi|86554269|gb|ABC99227.1| 4-hydroxybenzoate polyprenyl transferase [Synechococcus sp.
           JA-3-3Ab]
          Length = 300

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 110/215 (51%), Gaps = 21/215 (9%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLF-IYIVGAIVTRGAACT 83
           L RWH   G  + ++P LW   LA          G  T  W L  I I+G++ T GA C 
Sbjct: 18  LLRWHKPAGRLILMIPALWGAFLA----------GRGTPPWPLVGILILGSLATSGAGCV 67

Query: 84  WNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP--FVICVGF 141
            NDL D D+D  V RTR+RPL S + T    +V A+L    +  L L  NP  F +CV  
Sbjct: 68  INDLWDRDLDPLVERTRNRPLASRELTVAVGIVMALLTLACAAGLALFLNPVSFALCV-- 125

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF------FLCIGTI 195
           A + + LLYP +KR    PQ+VL + +   V + W A+               +L + T+
Sbjct: 126 AAVPVILLYPGAKRVFPVPQLVLALAWGFAVLISWTAVSGQDPHTPLWEEGLGWLWLATV 185

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
            W + FDTVYA  D++DDE  G++S+AR F  QT 
Sbjct: 186 LWTLGFDTVYALSDREDDERAGIHSSARFFGRQTP 220


>gi|242765719|ref|XP_002341031.1| para-hydroxybenzoate-polyprenyltransferase Coq2, putative
           [Talaromyces stipitatus ATCC 10500]
 gi|218724227|gb|EED23644.1| para-hydroxybenzoate-polyprenyltransferase Coq2, putative
           [Talaromyces stipitatus ATCC 10500]
          Length = 568

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 105/216 (48%), Gaps = 8/216 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R    TG +    PCL+ST+LAA PL       +  I  Y  ++  GA++ RGA
Sbjct: 117 PYAELIRLDKPTGTYYLFFPCLFSTLLAA-PLAMPMASPFE-ILAYTGLFFSGALIMRGA 174

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL D D D  V RT+ RP+  G  T  +A+VF   Q L    +LLQF    +  G
Sbjct: 175 GCTINDLWDKDFDPHVTRTKFRPIARGAVTPEKAIVFTGFQLLAGLGILLQFPLQCLYYG 234

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL------HASFSWPAFFLCIGT 194
              L     YP +KR    PQ VLG+ F+ G  +G+ AL      H      A  L    
Sbjct: 235 VPSLLFVATYPLAKRITYYPQAVLGLTFSWGAIMGFPALGVDLLSHTDALLSATALYSSC 294

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
           + W V +D +YAH D KDD   G+ S A    + TK
Sbjct: 295 VAWTVLYDMIYAHMDIKDDVAAGIKSIALRHEHNTK 330


>gi|284052764|ref|ZP_06382974.1| 4-hydroxybenzoate polyprenyltransferase [Arthrospira platensis str.
           Paraca]
 gi|291565857|dbj|BAI88129.1| probable 4-hydroxybenzoate- octaprenyltransferase [Arthrospira
           platensis NIES-39]
          Length = 294

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 103/204 (50%), Gaps = 9/204 (4%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           V L RW    G  + ++P LW+ VLA          G +     + + + G++ T  A C
Sbjct: 16  VRLLRWDKPAGRLILMIPALWAIVLAT---------GGTPPLTLILVIVFGSLATSAAGC 66

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFA 142
             NDL D +ID +V RTR+RPL S   T    +V A++ F  +F L L  NP    +  A
Sbjct: 67  VVNDLWDRNIDPEVERTRNRPLASRALTIKTGVVVALVAFACAFGLALYLNPLSFWLSVA 126

Query: 143 LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFD 202
            + + + YP +KR    PQ+VL I +   V + W A + S       L   T+ W + FD
Sbjct: 127 AVPVIICYPLAKRVFPVPQLVLSIAWGFAVLISWSAANGSLEATTGLLWGATVLWTLGFD 186

Query: 203 TVYAHQDKKDDELIGVNSTARLFS 226
           TVYA  D++DD  +G+NS+A  F 
Sbjct: 187 TVYAMSDREDDRRLGINSSALFFG 210


>gi|34581333|ref|ZP_00142813.1| 4-hydroxybenzoate octaprenyltransferase [Rickettsia sibirica 246]
 gi|28262718|gb|EAA26222.1| 4-hydroxybenzoate octaprenyltransferase [Rickettsia sibirica 246]
          Length = 282

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 139/273 (50%), Gaps = 12/273 (4%)

Query: 27  RWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWND 86
           R      + L   P L+  +LA+ P R       + +   L ++I+G+I  R + C  ND
Sbjct: 15  RADKLVAYLLVFFPALFGLLLAS-PSR-------TELIHLLPLFILGSITARSSGCIIND 66

Query: 87  LVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF-ALLF 145
           + D   D  V RT+ RPL S   +   A++   +  +IS  +LL  N   I +GF A++ 
Sbjct: 67  IFDRKFDKHVARTKERPLASKALSVSYAILILFILSVISLCILLLLNKTAIYIGFFAVIM 126

Query: 146 ISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVY 205
           ISL YP  KR    PQ+ LG  F  G  + + A+  +    A  + +   FW + +DT+Y
Sbjct: 127 ISL-YPLMKRITYFPQIFLGFTFKLGALIAYAAVQDTLDIAAIIMYLACCFWAIGYDTIY 185

Query: 206 AHQDKKDDELIGVNS-TARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIA 264
            + D +DD+ IGV S +  L S  +KLWL+I Y  F+L F++A  +   N   ++ +L A
Sbjct: 186 GYMDIRDDKKIGVKSLSIYLESKHSKLWLYICYIGFILLFILATKMANHN-IDYLPILAA 244

Query: 265 LFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
           L L I ++  LDI     C + F +   +G+++
Sbjct: 245 LILLILQVATLDIENPANCMTRFRANNYIGLVL 277


>gi|260767585|ref|ZP_05876521.1| 4-hydroxybenzoate polyprenyltransferase [Vibrio furnissii CIP
           102972]
 gi|260617485|gb|EEX42668.1| 4-hydroxybenzoate polyprenyltransferase [Vibrio furnissii CIP
           102972]
 gi|315178779|gb|ADT85693.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio furnissii NCTC
           11218]
          Length = 284

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 97/296 (32%), Positives = 141/296 (47%), Gaps = 20/296 (6%)

Query: 15  MGSAIA-PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVG 73
           M +A A  Y  L R     G  L + P +W+ +LAA  +    VL          ++++G
Sbjct: 1   MNTAKARAYWQLTRMDRPIGSLLLLWPTIWALILAARGMPDFNVL---------VVFVIG 51

Query: 74  AIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFN 133
               R A C  ND  D  +D  V RT  RPLP+G+ T  +A    VL  L+SF+L+L  N
Sbjct: 52  VFAMRSAGCVINDFADRKVDGHVKRTAQRPLPAGKVTAREAFTLFVLLSLLSFLLVLTMN 111

Query: 134 PFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIG 193
           P  I + FA L ++ +YPF KR+   PQ  LG+ F+  + + W A        A++L + 
Sbjct: 112 PLTIKLSFAGLILAFIYPFMKRYTHLPQFFLGLAFSWSIPMAWAAQSGELPLVAWYLFVI 171

Query: 194 TIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTV 253
            + W V +DT YA  D+ DD LIGV STA LF    KL    + G+  L  +     L  
Sbjct: 172 NVLWTVAYDTQYAMVDRDDDLLIGVKSTAILFGRFDKL----IIGVLQLLTIAMLIALGY 227

Query: 254 NF-----FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           +F     + W GLL A  L + +   +       C   F +   VG+ I + + IS
Sbjct: 228 SFQLGASYYW-GLLAASGLFVYQQHLIRHRDRMPCFQAFLNNNYVGMAIALGMFIS 282


>gi|119468072|ref|XP_001257842.1| UbiA family prenyltransferase, putative [Neosartorya fischeri NRRL
           181]
 gi|119405994|gb|EAW15945.1| UbiA family prenyltransferase, putative [Neosartorya fischeri NRRL
           181]
          Length = 354

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 85/256 (33%), Positives = 120/256 (46%), Gaps = 29/256 (11%)

Query: 14  IMGSAIAPYVYLARWHSSTG-----WHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLF 68
           IM  +  PY  L R     G     WH A+   L +++ +  P      L   ++F +  
Sbjct: 42  IMPPSWIPYAELMRLDRPAGYWAFYWHFAIGLALAASMSSPIP----SPLTLVSLFLFFA 97

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           +++   IV RGA CTWND +D D D +V RTR+RP+P G  +  Q+ +F + Q  +  V+
Sbjct: 98  VWV---IVLRGAVCTWNDTLDQDFDRRVSRTRNRPIPRGAVSTVQSHLFTLAQITVGTVM 154

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           LL      +     +  I L+YP  KR    PQV+LGI F   +F+   AL A     + 
Sbjct: 155 LLPLPRGCMYHAALMTAILLVYPLGKRVTDFPQVILGIAFGMPIFLCSAALDADPLPLSD 214

Query: 189 FLCIGT-----------------IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
           F  +GT                 I W V FDT+YAHQD KDD  +GV S A     +TK 
Sbjct: 215 FYRLGTETDDLRLLAALCFYIVSILWTVIFDTIYAHQDAKDDAKVGVRSLAVRLGDRTKQ 274

Query: 232 WLFILYGIFVLCFMVA 247
            L +L    V+    A
Sbjct: 275 ALSVLAATQVMLLFAA 290


>gi|154298136|ref|XP_001549492.1| hypothetical protein BC1G_12033 [Botryotinia fuckeliana B05.10]
 gi|150858219|gb|EDN33411.1| hypothetical protein BC1G_12033 [Botryotinia fuckeliana B05.10]
          Length = 463

 Score =  122 bits (305), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 116/219 (52%), Gaps = 14/219 (6%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G +    PCL+ST+LAA PL  A ++   T+     ++  GA++ RGA
Sbjct: 141 PYAELIRLDKPAGTYYLFFPCLFSTLLAA-PLT-APMVSPLTVVGTSLLFFSGALIMRGA 198

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL D ++D  V RTR RP+  G  + F+ALVF   Q      +LLQF P+  C  
Sbjct: 199 GCTINDLWDRNLDPNVTRTRLRPIARGAVSPFKALVFTGGQLFAGLAVLLQF-PYQ-CFF 256

Query: 141 FA---LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL------HASFSWPAFFLC 191
           +A   LLF++  YP +KR    PQ VLG+ F+ G  +G+ AL      +++      FL 
Sbjct: 257 YATPSLLFVA-SYPLAKRVTHYPQFVLGLTFSWGAIMGFPALGIDLLSNSAAMTATGFLY 315

Query: 192 IGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
              + W V +D +YAH D KDD   G+ S A     QTK
Sbjct: 316 ASNVAWTVLYDMIYAHMDIKDDAKAGIKSIALRHDAQTK 354


>gi|145535035|ref|XP_001453256.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124420967|emb|CAK85859.1| unnamed protein product [Paramecium tetraurelia]
          Length = 286

 Score =  122 bits (305), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 85/274 (31%), Positives = 127/274 (46%), Gaps = 15/274 (5%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           ++ ++ LAR     G  L  +PC+W T+L            +  I WY  ++ VG+   R
Sbjct: 5   LSAHLRLARHDKPIGALLLHIPCVWGTILGQ------PTFNFQEIIWYSSVFGVGSFTMR 58

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
            A C  ND+ D +ID++V RTR RPL SG+     A +       +  ++L Q +   I 
Sbjct: 59  AAGCVVNDMWDRNIDNKVERTRQRPLASGELQMKDAWISLFAHCSVGLLVLTQLSWSTIA 118

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT-IFW 197
             F ++ I+ LYP +KR+   PQ+VLGI F  GV VG G   A    P   L     I  
Sbjct: 119 ASFGIVPIAFLYPLAKRYFSYPQLVLGIAFNWGVVVG-GLQLAGMLNPTIMLGYAAGIVN 177

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFA 257
            + +DTVY HQDK+ D+ +G+ STA      T L+L      +V   ++       ++  
Sbjct: 178 TLIYDTVYGHQDKEYDKSLGLYSTAYTLPKNTPLYL-----TWVFSGLIGLTCYAASYHP 232

Query: 258 WIGLLIAL--FLTIKRIIALDISCSKQCCSFFHS 289
            +  LI L       R+ A D    + C  FF  
Sbjct: 233 GVYPLIVLNQLDMYLRLKATDFDNPESCGKFFRD 266


>gi|16332051|ref|NP_442779.1| 4-hydroxybenzoate polyprenyltransferase [Synechocystis sp. PCC
           6803]
 gi|1001363|dbj|BAA10850.1| 4-hydroxybenzoate-octaprenyl transferase [Synechocystis sp. PCC
           6803]
          Length = 292

 Score =  122 bits (305), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 117/243 (48%), Gaps = 9/243 (3%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           +YL RWH   G  + ++P LW+  LAA  L    +LG            +G + T G  C
Sbjct: 16  IYLLRWHKPAGRLILMIPALWAVCLAAQGLPPLPLLG---------TIALGTLATSGLGC 66

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFA 142
             NDL D DID QV RT+ RPL +   +    +  A++  L +  L     P    +  A
Sbjct: 67  VVNDLWDRDIDPQVERTKQRPLAARALSVQVGIGVALVALLCAAGLAFYLTPLSFWLCVA 126

Query: 143 LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFD 202
            + + + YP +KR    PQ+VL I +   V + W A+    +   + L   T+FW + FD
Sbjct: 127 AVPVIVAYPGAKRVFPVPQLVLSIAWGFAVLISWSAVTGDLTDATWVLWGATVFWTLGFD 186

Query: 203 TVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLL 262
           TVYA  D++DD  IGVNS+A  F       + I + + + C      +L +N   W+ L 
Sbjct: 187 TVYAMADREDDRRIGVNSSALFFGQYVGEAVGIFFALTIGCLFYLGMILMLNPLYWLSLA 246

Query: 263 IAL 265
           IA+
Sbjct: 247 IAI 249


>gi|308487836|ref|XP_003106113.1| CRE-COQ-2 protein [Caenorhabditis remanei]
 gi|308254687|gb|EFO98639.1| CRE-COQ-2 protein [Caenorhabditis remanei]
          Length = 382

 Score =  122 bits (305), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 135/293 (46%), Gaps = 10/293 (3%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L   PC WS  +A      AG L      + L ++  GA + R
Sbjct: 74  LKPYLQLMRVDKPIGTWLLYWPCTWSIAMAT----PAGQL---PSLYMLTLFGTGAFLMR 126

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
            A C  NDL D D D +V RT+ RPL  G  T  QA+         S  +LLQ N F + 
Sbjct: 127 SAGCVINDLWDKDFDKKVERTKLRPLACGSLTEKQAVGLLAGLLSSSLAILLQLNWFSVA 186

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTIFW 197
           VG + + + + YP +KR+   PQ +LG      V + W  +     +  F  L   TI  
Sbjct: 187 VGASSMALVVGYPLAKRYTYWPQFILGATLNWSVLIAWAEMGHIKDFGIFLPLYTATILH 246

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFA 257
            V +DT+Y+HQDK DD +IGV STA      TK WL   +G+  +  + A  + +   + 
Sbjct: 247 TVIYDTIYSHQDKADDIMIGVKSTALRLGEDTKKWLSA-FGVGTVASLTACGMASDQTWP 305

Query: 258 WIGLLIALFLTIK-RIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQ 309
           +   L A    +  ++  +DI     C   F S   +GI++   ++ S  L +
Sbjct: 306 YYVALAATTAQLGWQVGTVDIDNGSDCWDKFKSNSWMGIILFSGIVASTLLKE 358


>gi|239948421|ref|ZP_04700174.1| 4-hydroxybenzoate polyprenyl transferase [Rickettsia endosymbiont
           of Ixodes scapularis]
 gi|239922697|gb|EER22721.1| 4-hydroxybenzoate polyprenyl transferase [Rickettsia endosymbiont
           of Ixodes scapularis]
          Length = 282

 Score =  122 bits (305), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 88/277 (31%), Positives = 136/277 (49%), Gaps = 12/277 (4%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           + L R      + L   P L+  +LA  P         + +   L ++I+G+I+TR + C
Sbjct: 11  IKLIRADKPVAYLLVFFPALFGLLLAN-P-------SNTELAHLLPLFILGSIMTRSSGC 62

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF- 141
             ND+ D   D  V RT+ RPL S   +   A+    +  +IS  +LL  N   I  GF 
Sbjct: 63  IINDIFDRKFDKHVARTKDRPLASKALSVSYAIFILFILSVISLCILLLLNKTAIYTGFF 122

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A++ ISL YP  KR    PQ+ LG  F  G  + + A+       A  + I   FW + +
Sbjct: 123 AVIMISL-YPLMKRITYFPQIFLGFSFKLGALIAYAAVQDKLDMAAIIMYIACCFWAIGY 181

Query: 202 DTVYAHQDKKDDELIGVNS-TARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           DT+Y + D KDD+ IGV S +  L +   KLWL+I Y   +L F++A  +   N   ++ 
Sbjct: 182 DTIYGYMDIKDDKKIGVKSLSVYLENKHPKLWLYICYIGCILLFILATKMANHN-IDYLP 240

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
           +L AL + I ++  LDI     C + F +   VG+L+
Sbjct: 241 ILAALIILILQVATLDIENPTDCMTRFRANNYVGVLL 277


>gi|227357658|ref|ZP_03842010.1| 4-hydroxybenzoate octaprenyltransferase [Proteus mirabilis ATCC
           29906]
 gi|227162137|gb|EEI47145.1| 4-hydroxybenzoate octaprenyltransferase [Proteus mirabilis ATCC
           29906]
          Length = 288

 Score =  122 bits (305), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 92/288 (31%), Positives = 139/288 (48%), Gaps = 15/288 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P  W+  +AA      G   W      L ++ +G    R A 
Sbjct: 13  YSRLMRIDKPIGALLLLWPTYWALWIAA-----KGFPDWHI----LIVFTLGVFSMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  ID  V RT++RPLPSG  T  ++ +  ++  L SF L+L  N   I +  
Sbjct: 64  CVINDFADRKIDGNVERTKNRPLPSGAVTEKESKIIFIVLVLFSFGLVLTLNTMTIWLSI 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++  YPF KRF   PQ++LG+ F   + +G+ A+  +     + L +  I W V +
Sbjct: 124 AALALAWFYPFVKRFSNLPQLILGMAFGWSIPMGFAAVSETLPLVCWLLFLVNIIWSVVY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLL--TVNFFAWI 259
           DT YA  D+ DD  IGV STA LF    K+ + IL  + +L  +VA  +L      + W 
Sbjct: 184 DTQYAMVDRNDDLKIGVKSTAILFGRYDKIIIGILQ-LVMLALLVAIGILLNMKGIYYWS 242

Query: 260 GLLI-ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
            LL+ ALF+  +++IA        C   F +   VG ++   ++ + F
Sbjct: 243 LLLVTALFIYQQKLIAERERAP--CFQAFMNNNYVGFVLFAGILFNYF 288


>gi|197286581|ref|YP_002152453.1| 4-hydroxybenzoate octaprenyltransferase [Proteus mirabilis HI4320]
 gi|194684068|emb|CAR45426.1| 4-hydroxybenzoate octaprenyltransferase [Proteus mirabilis HI4320]
          Length = 284

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 90/287 (31%), Positives = 137/287 (47%), Gaps = 13/287 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P  W+  +AA      G   W      L ++ +G    R A 
Sbjct: 9   YSRLMRIDKPIGALLLLWPTYWALWIAA-----KGFPDWHI----LIVFTLGVFSMRAAG 59

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  ID  V RT++RPLPSG  T  ++ +  ++  L SF L+L  N   I +  
Sbjct: 60  CVINDFADRKIDGNVERTKNRPLPSGAVTEKESKIIFIVLVLFSFGLVLTLNTMTIWLSI 119

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++  YPF KRF   PQ++LG+ F   + +G+ A+  +     + L +  I W V +
Sbjct: 120 AALALAWFYPFVKRFSNLPQLILGMAFGWSIPMGFAAVSETLPLVCWLLFLVNIIWSVVY 179

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN-FFAWIG 260
           DT YA  D+ DD  IGV STA LF    K+ + IL  + +   +    LL +   + W  
Sbjct: 180 DTQYAMVDRNDDLKIGVKSTAILFGRYDKIIIGILQLVMLALLVAIGVLLNMKGIYYWSL 239

Query: 261 LLI-ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
           LL+ ALF+  +++IA        C   F +   VG ++   ++ + F
Sbjct: 240 LLVTALFIYQQKLIAERERAP--CFQAFMNNNYVGFVLFAGILFNYF 284


>gi|117618850|ref|YP_854714.1| 4-hydroxybenzoate octaprenyltransferase [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|189036982|sp|A0KEP9|UBIA_AERHH RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|117560257|gb|ABK37205.1| 4-hydroxybenzoate polyprenyl transferase [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 287

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 95/168 (56%), Gaps = 2/168 (1%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQAL-VFAVLQF 122
            W L +++VG  + R A C  ND  D + D  V RT  RPLP G+    + L +FAVL  
Sbjct: 45  LWTLLVFVVGVFLMRSAGCVINDYADRNFDGHVKRTAGRPLPMGKVKPREVLALFAVLA- 103

Query: 123 LISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHAS 182
           LISF L+L  NP  I + FA L +++ YPF KR+I  PQ+VLG+ F+  + + + A   +
Sbjct: 104 LISFALVLTMNPLTIGLSFAALLLAVCYPFMKRYIPIPQLVLGMAFSWSIPMAYAAQANA 163

Query: 183 FSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
               A+ + +  + W + +DT YA  D+ DD  +G+ S+A LF    K
Sbjct: 164 LPAVAWLVFLANLLWTIAYDTQYAMVDRDDDLKLGLKSSAILFGRHDK 211


>gi|237801803|ref|ZP_04590264.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331024662|gb|EGI04718.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 296

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 107/210 (50%), Gaps = 9/210 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G++L + P LW+  +A       G     T+     I++VGA + R A 
Sbjct: 19  FIQLTRIDRPIGFYLLLWPTLWAIWIAG-----KGSPSLKTVV----IFVVGAFLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL SG+ +  +AL    +  + SFVL+L  NP  I + F
Sbjct: 70  CVINDFADRKVDGHVKRTEQRPLVSGKISAREALALFAVLVVTSFVLVLFTNPTTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAATYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGDLPAAAWLLYIANVLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
           DT YA  D+ DD  IGV STA LF    ++
Sbjct: 190 DTYYAMVDRDDDLKIGVKSTAVLFGDADRV 219


>gi|116199709|ref|XP_001225666.1| hypothetical protein CHGG_08010 [Chaetomium globosum CBS 148.51]
 gi|88179289|gb|EAQ86757.1| hypothetical protein CHGG_08010 [Chaetomium globosum CBS 148.51]
          Length = 409

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 127/273 (46%), Gaps = 15/273 (5%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R    TG +    PC++ST+LAA PL         T+     +++ GAIV RGA
Sbjct: 106 PYAELIRLDKPTGSYYLYFPCIFSTLLAA-PLAVPTTPPL-TVLGTSLLFLAGAIVMRGA 163

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL D ++D  V RTR RP+  G  T F+A++F   Q L    +LLQF        
Sbjct: 164 GCTINDLWDRNLDPHVARTRLRPIARGAVTPFRAVIFTGAQLLAGLAVLLQFPLSCFFYA 223

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL------HASFSWPAFFLCIGT 194
              L +   YP +KR    PQ VLG+ F+ G  +G+ AL      + +    A  L    
Sbjct: 224 TPSLLLVATYPLAKRVTYYPQFVLGLTFSWGAIMGFPALGVDLLHNGAAQAAAACLYASN 283

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLT 252
           + W V +D +YAH D KDD   G+ S A     +TK  L    +  + +L          
Sbjct: 284 VAWTVLYDMIYAHMDIKDDAKAGIKSIALKHDRETKQVLSGLAVAQVALLAGAGIATGAG 343

Query: 253 VNFFAWI--GLLIALFLTIKRIIALDISCSKQC 283
             FF     G L+ L + IKR+   ++   K C
Sbjct: 344 PAFFVGSCGGALVTLGIMIKRV---NLKSVKDC 373


>gi|89092213|ref|ZP_01165167.1| 4-hydroxybenzoate polyprenyl transferase [Oceanospirillum sp.
           MED92]
 gi|89083301|gb|EAR62519.1| 4-hydroxybenzoate polyprenyl transferase [Oceanospirillum sp.
           MED92]
          Length = 295

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 97/289 (33%), Positives = 140/289 (48%), Gaps = 10/289 (3%)

Query: 13  CIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIV 72
            +M  A A Y  L R     G +L + P  W+  +AA      G+  +      LFI+ +
Sbjct: 11  SLMKKAKA-YGRLMRVEKPIGTYLLLWPAYWALWIAA-----EGIPPYDI----LFIFTL 60

Query: 73  GAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQF 132
           G  +TR A C  ND  D  ID  V RT  RP+P+G  T  +AL+      LI+FVL+L  
Sbjct: 61  GVFLTRSAGCVINDFADRKIDGHVKRTALRPIPAGLVTAKEALILFAGLMLIAFVLVLFT 120

Query: 133 NPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI 192
           N   I +    L ++  YPF KR+   PQVVLG  FA  + + + A+  S    A+ + I
Sbjct: 121 NLNTILLSAGGLLLAACYPFMKRYTHLPQVVLGAAFAWSIPMAFTAVTDSVPLYAWLIYI 180

Query: 193 GTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLT 252
            T+ W V +DT+YA  D+ DD  IGV STA LF Y  K  + IL    +L  ++    + 
Sbjct: 181 ATLLWTVAYDTMYAMVDRDDDLKIGVKSTAILFGYADKFIIGILQLSTLLSLILLALQVN 240

Query: 253 VNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICL 301
           +  F ++GL  A  L I +   +       C   F +    G+LI + L
Sbjct: 241 LGLFFYLGLAGAALLFIYQQWLIRDRERDPCFKAFLNNHYAGLLIFVGL 289


>gi|32565247|ref|NP_871684.1| COenzyme Q (ubiquinone) biosynthesis family member (coq-2)
           [Caenorhabditis elegans]
 gi|24636040|gb|AAN63396.1| Coenzyme q (ubiquinone) biosynthesis protein 2, isoform e,
           confirmed by transcript evidence [Caenorhabditis
           elegans]
          Length = 370

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 94/294 (31%), Positives = 137/294 (46%), Gaps = 12/294 (4%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L   PC WS  +A      AG L      + L ++  GA + R
Sbjct: 62  LKPYLQLMRVDKPIGTWLLYWPCTWSIAMAT----PAGQL---PSIYMLSLFGAGAFLMR 114

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
            A C  NDL D D D +V RT+ RPL  G  T  QA+         S  +LLQ N + + 
Sbjct: 115 SAGCVINDLWDKDFDKKVERTKLRPLACGSLTEKQAIGLLAGLLSSSLAILLQLNWYSVA 174

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI--GTIF 196
           VG + + + + YP +KRF   PQ VLG      V + W  L   F+    FL +   TI 
Sbjct: 175 VGASSMALVVGYPLAKRFTYWPQFVLGATLNWSVLIAWAEL-GHFNDFGIFLPLYTATIL 233

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
             V +DT+Y+HQDK DD +IGV STA      TK WL   +G+  +  + A  + +   +
Sbjct: 234 HTVIYDTIYSHQDKADDIMIGVKSTALRLGADTKKWLSA-FGVGTVASLTACGIASDQTW 292

Query: 257 AWIGLLIALFLTIK-RIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQ 309
            +   L A    +  ++  +DI     C   F S   +GI++   ++ S  L +
Sbjct: 293 PYYVALAATTAQLGWQVGTVDIDNGSDCWDKFKSNSWMGIILFSGIVASTLLKE 346


>gi|324499894|gb|ADY39966.1| Para-hydroxybenzoate--polyprenyltransferase [Ascaris suum]
          Length = 367

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 81/215 (37%), Positives = 109/215 (50%), Gaps = 7/215 (3%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L   PC WS  LA  P    GVL      + L ++  G+   R
Sbjct: 64  MQPYLRLMRVDKPAGTWLLYWPCTWSIALATPP----GVL---PSIYLLALFGAGSFFMR 116

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
            A C  ND+ D   D +V RTR RPL SG+ T   A+        +S ++LLQ N   + 
Sbjct: 117 AAGCIINDIFDKKYDMKVERTRLRPLCSGELTNMDAIKLLSGLLSMSLLILLQLNWLSVA 176

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +G + L +++ YPF+KR+   PQ VLG     GV + W  L  +       L I  +F  
Sbjct: 177 IGASSLLLAVAYPFAKRYTYWPQFVLGATLNWGVLIAWSHLAPNALSTVIPLFIANVFHT 236

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
           V +DT+Y+HQDK DD + GV STA LF   TK WL
Sbjct: 237 VIYDTIYSHQDKADDIVAGVKSTALLFGDATKYWL 271


>gi|297537286|ref|YP_003673055.1| 4-hydroxybenzoate polyprenyl transferase [Methylotenera sp. 301]
 gi|297256633|gb|ADI28478.1| 4-hydroxybenzoate polyprenyl transferase [Methylotenera sp. 301]
          Length = 290

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/269 (29%), Positives = 128/269 (47%), Gaps = 10/269 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+ ++A +     G   W  +     I++ G ++ R A 
Sbjct: 13  YERLMRLDKPIGILLLLWPTLWALLIAGH-----GKPDWIVVL----IFVTGTVLMRSAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND+ D + D  V RTR RPL + + ++ +A   A    L++F L+   N   I +  
Sbjct: 64  CVMNDIADSEYDGLVERTRHRPLVNHEVSKKEAYFLAAGLSLVAFGLVCTLNTLTIKLSM 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             LF++  YPF+KRF   PQ  LGI F  G+ + + A+       A+ L +  +FW V +
Sbjct: 124 LALFLAASYPFTKRFFAIPQAYLGIAFGAGIPMAFAAILGYVPPVAWLLLLANVFWAVAY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IG+ S+A  F     + + I Y + +L  ++    L + +  +IGL
Sbjct: 184 DTEYAMVDRDDDLKIGIKSSAITFGKFDVVIVMICYALTLLILVICGIWLIMGYAYYIGL 243

Query: 262 LIALFLTIKRIIALDISCSKQC-CSFFHS 289
           + A  + I     +       C  +F H+
Sbjct: 244 IAAAAVAIYHYYLIRAREKTNCFKAFLHN 272


>gi|325981513|ref|YP_004293915.1| 4-hydroxybenzoate octaprenyltransferase [Nitrosomonas sp. AL212]
 gi|325531032|gb|ADZ25753.1| 4-hydroxybenzoate octaprenyltransferase [Nitrosomonas sp. AL212]
          Length = 289

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 81/256 (31%), Positives = 126/256 (49%), Gaps = 21/256 (8%)

Query: 15  MGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGA 74
           +   I  Y  L R     G  L + P LW    AA  L    +L         FI+++G 
Sbjct: 3   IADRIRTYSQLMRLDKPIGILLLLWPMLWGLWFAAKGLPDGHIL---------FIFVLGT 53

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
           ++ R A C  ND  D +ID  V RT++RP+ +G+ +  +AL+ A      +F+L+L  N 
Sbjct: 54  VLMRSAGCVINDFADREIDPYVERTKNRPMAAGRVSSKEALLLAAGLSGGAFLLILPLNQ 113

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT 194
             I +    LF++  YPF+KRF   PQ  LGI F+ G+ + + A   S       L +  
Sbjct: 114 LTILLSVPALFLAGTYPFTKRFFAMPQAYLGIAFSFGIPMAFAAQTDSLPMITGILMLAN 173

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFV--LCFMVAFCLL- 251
           +FWV+ +DT YA  DK DD  IG+ ++A        L  F + G+ V  +CF+V   ++ 
Sbjct: 174 LFWVIAYDTAYAMVDKPDDLKIGIKTSA------ITLGQFDVLGVMVCHVCFIVIMIVIG 227

Query: 252 ---TVNFFAWIGLLIA 264
               +N   + GL++A
Sbjct: 228 QWQQMNLAYYAGLVVA 243


>gi|254582388|ref|XP_002497179.1| ZYRO0D17248p [Zygosaccharomyces rouxii]
 gi|186703817|emb|CAQ43506.1| Para-hydroxybenzoate--polyprenyltransferase [Zygosaccharomyces
           rouxii]
 gi|238940071|emb|CAR28246.1| ZYRO0D17248p [Zygosaccharomyces rouxii]
          Length = 361

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 88/294 (29%), Positives = 136/294 (46%), Gaps = 10/294 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L  LP  W+ + AA  +       + +  W L ++ VG+++ RGA
Sbjct: 71  PYAELMRLEKPVGTWLLYLPGTWAILTAAMQVSAP----FGSTLWMLGLFGVGSLIMRGA 126

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL+D D+DS+V+R+  RP+ SG+ TR Q L F   Q  +   +L Q       +G
Sbjct: 127 GCTINDLLDRDLDSKVIRSVERPIASGRITRRQGLAFLGAQTTVGVGILSQLPADCWWLG 186

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L +   YP  KRF   PQ +L   F     +G+ A+          L  G++ W + 
Sbjct: 187 LASLPLVFTYPLFKRFTYYPQAMLSACFNWAALLGFPAMGVMDLPTMIPLYAGSVLWCMI 246

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFIL----YGIFVLCFMVAFCLLTVNFF 256
           +DT+YAHQDKK D   GV STA  +  ++K  +  +    + ++ +  + +  L    F 
Sbjct: 247 YDTIYAHQDKKFDVKAGVKSTALAWGDRSKKIMNYMATCQFSLYAIAGLNSGLLWGPGFI 306

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
              GL I  +     I  +D++    C   F S    G+     L++   L  F
Sbjct: 307 G--GLSIFAYRVFTMIRKVDLNNPADCWKNFTSNINTGLYFSGALLVDYLLRLF 358


>gi|238651003|ref|YP_002916859.1| prenyltransferase [Rickettsia peacockii str. Rustic]
 gi|238625101|gb|ACR47807.1| prenyltransferase [Rickettsia peacockii str. Rustic]
          Length = 282

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 138/273 (50%), Gaps = 12/273 (4%)

Query: 27  RWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWND 86
           R      + L   P L+  +LA  P R       + +   L ++I+G+I  R + C  ND
Sbjct: 15  RVDKLVAYLLVFFPALFGLLLAN-PSR-------TELIHLLPLFILGSITARSSGCIIND 66

Query: 87  LVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF-ALLF 145
           + D   D  V RT+ RPL S   +   A++   +  +IS  +LL  N   I +GF A++ 
Sbjct: 67  IFDRKFDKHVARTKERPLASKALSVSYAILILFILSVISLCILLLLNKTAIYIGFFAVIM 126

Query: 146 ISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVY 205
           ISL YP  KR    PQ+ LG  F  G  + + A+  +    A  + +   FW + +DT+Y
Sbjct: 127 ISL-YPLMKRITYFPQIFLGFTFKLGALIAYAAVQDTLDIAAIIMYLACCFWAIGYDTIY 185

Query: 206 AHQDKKDDELIGVNS-TARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIA 264
            + D KDD+ IGV S +  L +  +KLWL+I Y  F+L F++A  +   N   ++ +L A
Sbjct: 186 GYMDIKDDKKIGVKSLSIYLENKHSKLWLYICYIGFILLFILATKMANHN-IDYLPILAA 244

Query: 265 LFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
           L L I ++  LDI     C + F +   +G+++
Sbjct: 245 LILLILQVATLDIENPANCMTRFRANNYIGLVL 277


>gi|254509257|ref|ZP_05121351.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio parahaemolyticus
           16]
 gi|219547811|gb|EED24842.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio parahaemolyticus
           16]
          Length = 270

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 126/240 (52%), Gaps = 4/240 (1%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L ++I+G +  R A C  ND  D  +D  V RT  RPLPSG+ T  +A+   ++  + SF
Sbjct: 31  LVVFILGVVFMRAAGCVINDFADRKVDGHVKRTSQRPLPSGRVTSKEAITLFIILGVASF 90

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+L  NP  I + FA + ++ +YPF KRF   PQ+ LG+ F+  + + W A        
Sbjct: 91  LLVLTMNPLTIALSFAGIVLAFIYPFMKRFTHLPQLFLGLAFSWSIPMAWAAQANELPMV 150

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIF--VLCF 244
            +F+      W + +DT YA  D+ DD  IG+ STA LF    K+ + +L  I   +L +
Sbjct: 151 VWFVFAINALWTIAYDTQYAMVDRDDDLKIGIKSTAILFGRFDKMVIGVLQLITLAMLIY 210

Query: 245 MVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           +  +  L  +F+ W  LLIA  L + +   +     + C   F +   VG++I I L+I+
Sbjct: 211 LGVWYQLGASFY-W-SLLIAGALFVFQQHLIRHRERELCFRAFLNNNYVGMVIAIGLLIA 268


>gi|124516700|gb|EAY58208.1| putative 4-hydroxybenzoate polyprenyl transferase [Leptospirillum
           rubarum]
          Length = 287

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 111/214 (51%), Gaps = 14/214 (6%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           L R+    G  L  +P LW  +LAA+        G       + ++  GA V R A C  
Sbjct: 10  LIRFRRPVGTLLLFMPALWG-LLAAW--------GGKPPVSMILLFGTGAFVMRSAGCAI 60

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCT-RFQALVFAVLQFLISFVLLLQFNPFVICVGFAL 143
           ND++D ++D +V RTR RPLPSG+ + R   LVF  L F ++  LLL  +P    V  A 
Sbjct: 61  NDILDRNVDGKVWRTRDRPLPSGRLSLRTAWLVFLALSF-VAASLLLFLHPLTRMVALAG 119

Query: 144 LFISLLYPFSKRFILCPQVVLGIGFA-GGVFVGWGALHASFSWPAFFLCIGTIFWVVYFD 202
              ++LYP  KRF+  PQ+ +GI F      + W     +  WPAF + +G +FW   +D
Sbjct: 120 FGATMLYPLMKRFMPLPQIFMGIPFGMTAPLMAWAEGRGTLGWPAFMIALGGLFWATTYD 179

Query: 203 TVYAHQDKKDDELIGVNSTARLFSYQTKLWLFIL 236
            VYA  D++DD   G+ S A   ++  +LW+ IL
Sbjct: 180 LVYAIADREDDIKAGICSGA--VTFGDRLWIAIL 211


>gi|28197990|ref|NP_778304.1| 4-hydroxybenzoate octaprenyltransferase [Xylella fastidiosa
           Temecula1]
 gi|182680616|ref|YP_001828776.1| 4-hydroxybenzoate octaprenyltransferase [Xylella fastidiosa M23]
 gi|81439230|sp|Q87F82|UBIA_XYLFT RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790307|sp|B2I675|UBIA_XYLF2 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|28056050|gb|AAO27953.1| hydroxybenzoate octaprenyltransferase [Xylella fastidiosa
           Temecula1]
 gi|182630726|gb|ACB91502.1| 4-hydroxybenzoate polyprenyl transferase [Xylella fastidiosa M23]
 gi|307579075|gb|ADN63044.1| 4-hydroxybenzoate octaprenyltransferase [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 299

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 89/281 (31%), Positives = 132/281 (46%), Gaps = 9/281 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           + + PY  LAR     G+ L + P  W+  LAA      GV  W    W L ++  G  +
Sbjct: 18  NRLDPYWKLARGDRPVGFLLLLWPTWWALWLAA-----DGVPPW----WTLCVFTTGIWL 68

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
           TR A C  ND  D  +D  V RT +RPL +G  +   AL+      LI+F L+L  N   
Sbjct: 69  TRSAGCVINDYTDRWLDPHVERTCTRPLVTGTVSPRNALLMFGTLMLIAFGLVLTMNRLT 128

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           + +  A LF+++ YP+ KR+   PQV LGI F  G+ + + A+       A+ L +  I 
Sbjct: 129 VLLSVAGLFLAMTYPYLKRYTHLPQVYLGIAFGWGIPMAFAAIQGKVPTLAWLLYVANIL 188

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
           W   +DT YA  D+ DD  +G  STA LF+    +   +LY + +L   +     T++  
Sbjct: 189 WTTAYDTWYAMVDRDDDIKMGAKSTAILFADLDLVVQGVLYTLMLLTLCLVGLRATLSHT 248

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
            WI L+ A+ L   + I         C   F     VG+ I
Sbjct: 249 YWISLISAVALIGYQFIIARRREPTACFRAFMHNNWVGMTI 289


>gi|82703724|ref|YP_413290.1| 4-hydroxybenzoate octaprenyltransferase [Nitrosospira multiformis
           ATCC 25196]
 gi|118574209|sp|Q2Y5S3|UBIA_NITMU RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|82411789|gb|ABB75898.1| 4-hydroxybenzoate octaprenyltransferase [Nitrosospira multiformis
           ATCC 25196]
          Length = 290

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 91/284 (32%), Positives = 137/284 (48%), Gaps = 11/284 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW   LAA  + R  +L          I+++G ++ R A 
Sbjct: 10  YEKLMRLDKPIGILLLLWPTLWGLWLAAEGVPRLDIL---------LIFVLGTVLMRSAG 60

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D + D  V RTR+RPL  G  +  +AL+ A    L++F+L+   N   I + F
Sbjct: 61  CVVNDYADRNFDGHVERTRTRPLALGAVSTREALLLAAGLSLVAFLLIQPLNRLTIELSF 120

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             LF++  YPF+KRF   PQ  LGI F+ G+ + + A      +PA+FL    + WV+ +
Sbjct: 121 VALFLAASYPFTKRFFAMPQAYLGIAFSFGIPMAFAAQTGEVPFPAWFLMGANLLWVIAY 180

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLL-TVNFFAWIG 260
           DT YA  DK DD  IG+ ++A  F     + + + +  F L  MVA  LL  +    +IG
Sbjct: 181 DTEYAMVDKVDDLRIGIKTSAITFGRFDVVGVVLCHMAF-LAGMVAIGLLQNLGVIYYIG 239

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           L  AL L + +   +      +C   F     VG  I   +++ 
Sbjct: 240 LATALGLILYQYRLIHDRDRARCFKAFLHNNWVGATIFAGIVLD 283


>gi|149191755|ref|ZP_01869994.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio shilonii AK1]
 gi|148834397|gb|EDL51395.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio shilonii AK1]
          Length = 285

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 110/218 (50%), Gaps = 10/218 (4%)

Query: 15  MGSAIAP-YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVG 73
           M SA A  Y  L R     G  L + P LW+ +LAA  +    VL          ++ +G
Sbjct: 1   MTSAKAKAYWQLMRMDKPIGSLLLLWPTLWALILAAEGIPDLHVL---------VVFSLG 51

Query: 74  AIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFN 133
            I+ R A C  ND  D  +D  V RT+ RPLP+G  +  +A+   +   + SF+L+L  N
Sbjct: 52  VIMMRSAGCVINDFADRKVDGHVERTKLRPLPAGLVSSREAIALFLFLAIASFILVLTMN 111

Query: 134 PFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIG 193
              I + F  LF++ +YPF KR+   PQ+ LG+ F+  + + W A         +F+ + 
Sbjct: 112 TLTIQLSFVGLFLAFIYPFMKRYTHLPQLFLGLAFSWSIPMAWAAQANELPPMVWFVFVI 171

Query: 194 TIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
              W + +DT YA  D+ DD  +G+ STA LF  + KL
Sbjct: 172 NALWTIGYDTQYAMVDRDDDLKVGIKSTAILFGRRDKL 209


>gi|148244245|ref|YP_001218939.1| 4-hydroxybenzoate octaprenyltransferase [Candidatus Vesicomyosocius
           okutanii HA]
 gi|146326072|dbj|BAF61215.1| 4-hydroxybenzoate octaprenyltransferase [Candidatus Vesicomyosocius
           okutanii HA]
          Length = 289

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 113/210 (53%), Gaps = 9/210 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           ++   Y+ L R  +  G +L + P LW+  LA+       +L          I+++G ++
Sbjct: 8   TSFVAYLRLMRLDNPIGIYLLLWPTLWALFLASEGFPDLKLL---------LIFVLGVVL 58

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  ND  D  ID  V RT+ RP+ SG+     AL F VL  +++F+L+L  N   
Sbjct: 59  MRSAGCVINDYADRYIDKLVERTKHRPITSGEIHHRSALKFFVLLIMLAFLLVLLTNWLT 118

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I +    + +++LYPF+KR+   PQ VLG+ FA  V + + A        A+++   T+ 
Sbjct: 119 IQLAMIAVLLAILYPFTKRWTYFPQFVLGLAFAMSVLMAFSATLNEIPITAWYVFAATVI 178

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFS 226
           W V +DT+YA  D+++D  IG+ S+A LF+
Sbjct: 179 WTVIYDTMYAMADREEDLKIGIKSSAILFA 208


>gi|121603241|ref|YP_980570.1| 4-hydroxybenzoate polyprenyl transferase [Polaromonas
           naphthalenivorans CJ2]
 gi|189036996|sp|A1VJ21|UBIA_POLNA RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|120592210|gb|ABM35649.1| 4-hydroxybenzoate octaprenyltransferase [Polaromonas
           naphthalenivorans CJ2]
          Length = 289

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 113/206 (54%), Gaps = 9/206 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S  + Y+ L RW+   GW L + P L +  LA++     G  GW  +     ++ +G  +
Sbjct: 7   SKFSLYLQLIRWNRPAGWLLLLWPTLSALWLASH-----GFPGWHLVT----VFTLGTFL 57

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  ND+ D D D  V RT  RP+ SG  +  +AL    +  L++F L+L  N   
Sbjct: 58  MRSAGCCINDVADRDFDRHVKRTAQRPVTSGAVSVREALGLGAVLALLAFGLVLTTNAVT 117

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I   FA L ++L YPF+KR++  PQ VLG+ F+ G+ + + A+ +     A+ L +G +F
Sbjct: 118 IAWSFAALAVTLAYPFAKRYVSMPQAVLGVAFSCGILMAFAAVQSRVPPLAWALLLGNLF 177

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTA 222
           WV+ +DT YA  D+ DD  IG+ ++A
Sbjct: 178 WVIAYDTEYAMVDRDDDLKIGMKTSA 203


>gi|57239306|ref|YP_180442.1| 4-hydroxybenzoate polyprenyltransferase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579272|ref|YP_197484.1| prenyltransferase [Ehrlichia ruminantium str. Welgevonden]
 gi|58617326|ref|YP_196525.1| prenyltransferase [Ehrlichia ruminantium str. Gardel]
 gi|57161385|emb|CAH58309.1| 4-hydroxybenzoate octaprenyltransferase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58416938|emb|CAI28051.1| 4-hydroxybenzoate octaprenyltransferase [Ehrlichia ruminantium str.
           Gardel]
 gi|58417898|emb|CAI27102.1| 4-hydroxybenzoate octaprenyltransferase [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 295

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 80/225 (35%), Positives = 117/225 (52%), Gaps = 8/225 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S    Y +L R HS     L V P   S +L +  L R  +        Y+F+ +VG+ +
Sbjct: 12  SDFKGYYFLLRLHSVWIICLLVFPSCTSILLVSNNLLRDTL--------YMFLCLVGSFL 63

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  ND+ D  ID  V RT+SRPL +G  + FQAL    +  L + VLL+  N + 
Sbjct: 64  MRSAGCIINDICDRKIDIAVERTKSRPLANGSLSVFQALKVLAVLLLCASVLLVFTNMYT 123

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           + +    + + +LYP +KR    PQ++LGI F  GV +G   +    +  +  L IG IF
Sbjct: 124 VKISLVTMVLIILYPLAKRCFSWPQLLLGIVFNSGVLMGCTMVIGHLALSSVLLYIGCIF 183

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFV 241
           W + +DT+YA QDKK D  +G+ STA  F    + W+  LY I +
Sbjct: 184 WTLGYDTIYAAQDKKYDMQLGLKSTAIEFGDNIRSWIKRLYIIVI 228


>gi|323303228|gb|EGA57027.1| Coq2p [Saccharomyces cerevisiae FostersB]
          Length = 372

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 95/296 (32%), Positives = 137/296 (46%), Gaps = 14/296 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L  LPC WS ++ A  + +   L  S     L I+ VGA+V RGA
Sbjct: 82  PYAELMRLEKPVGTWLLYLPCSWSILMGA--MMQGATL--SATAGMLGIFGVGALVMRGA 137

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT N  +D  +D +V+R+  RP+ SG+ +  +ALVF   Q L+   +L         +G
Sbjct: 138 GCTINXFLDRKLDQRVIRSVERPIASGRVSPRRALVFLGAQTLVGMGVLSLLPAQCWWLG 197

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTIFWVV 199
            A L I   YP  KRF   PQ  L   F  G  +G+ A+    SWP    L + +  W +
Sbjct: 198 LASLPIVFTYPLFKRFTYYPQAALSACFNWGALLGFPAMGV-MSWPTMIPLYLSSYLWCM 256

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA----FCLLTVNF 255
            +DT+YAHQDKK D   G+ STA  +  +TK  +  +    +    VA      L    F
Sbjct: 257 TYDTIYAHQDKKFDIKAGIKSTALAWGPRTKSIMKAMSASQIALLAVAGLNSGLLWGPGF 316

Query: 256 FAWIGLLI-ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
              +G+    LF  IK++   D+   K C  +F++    G+     L +   L  F
Sbjct: 317 IGGLGVFAYRLFSMIKKV---DLDNPKNCWKYFNANINTGLYFTYALAVDYILRLF 369


>gi|331245967|ref|XP_003335618.1| para-hydroxybenzoate-polyprenyltransferase [Puccinia graminis f.
           sp. tritici CRL 75-36-700-3]
 gi|309314608|gb|EFP91199.1| para-hydroxybenzoate-polyprenyltransferase [Puccinia graminis f.
           sp. tritici CRL 75-36-700-3]
          Length = 392

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 110/208 (52%), Gaps = 5/208 (2%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           I PY+ L+R  +  G  L  LPC  S  LAA     +       +     ++ +GA V R
Sbjct: 101 IEPYLALSRVRAPIGAALLFLPCGSSLALAASSAAVSPQF----LIAQTCLFGLGAFVMR 156

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT NDL D  ID +V RT+ RPL SG  +   A+ +  LQ  I   +LLQ N + I 
Sbjct: 157 GAGCTINDLWDRSIDQKVSRTQLRPLASGALSPANAIGWLGLQLSIGLAILLQLNIYSIL 216

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP-AFFLCIGTIFW 197
           +G + L + ++YP  KR    PQ VLG+ F  G  +G  A+     W  +  L +G I W
Sbjct: 217 LGASSLSLVIIYPLMKRITYWPQFVLGLAFNWGALLGSSAILGQTDWKVSIPLYVGHICW 276

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLF 225
            + +DT+YA QDKK D L GV STA LF
Sbjct: 277 TIVYDTIYAQQDKKSDVLAGVKSTALLF 304


>gi|77461825|ref|YP_351332.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas fluorescens
           Pf0-1]
 gi|118574216|sp|Q3K4G3|UBIA_PSEPF RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|77385828|gb|ABA77341.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas fluorescens
           Pf0-1]
          Length = 296

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/243 (31%), Positives = 121/243 (49%), Gaps = 9/243 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +A            S     + I+++G ++TR   
Sbjct: 19  FIQLTRMDKPIGIYLLLWPTLWALWIAGKG---------SPSLANIVIFVLGVVLTRAGG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RP+ +G+ +  +ALVF  L   +SF+L+L  N   I +  
Sbjct: 70  CVINDWADRKVDGHVKRTAQRPIAAGKISSKEALVFFALLMGVSFLLVLCTNAATIWLSL 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F+ G+ + + A        A+ L I  + W V +
Sbjct: 130 GGLALAFTYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGELPATAWLLWIANLLWTVGY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    ++ +  L  + + C ++A     +  +  +GL
Sbjct: 190 DTYYAMTDRDDDLKIGVKSTAILFGDADRVIILTLQVLSLGCLVLAGSKFELGMWFHLGL 249

Query: 262 LIA 264
           L+A
Sbjct: 250 LVA 252


>gi|197103995|ref|YP_002129372.1| 4-hydroxybenzoate octaprenyltransferase [Phenylobacterium zucineum
           HLK1]
 gi|196477415|gb|ACG76943.1| 4-hydroxybenzoate octaprenyltransferase [Phenylobacterium zucineum
           HLK1]
          Length = 305

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 87/230 (37%), Positives = 113/230 (49%), Gaps = 7/230 (3%)

Query: 8   KWVRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
            WV D    + + P++ L R+   TG  L +LP      LA     R   L        L
Sbjct: 12  NWV-DRHAPAGLRPWLKLGRFDRPTGVWLLMLPGWQGVALAGLATGRGPDLA------LL 64

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
               VGA + R A C +ND+VD DID++V RT  RP+PSGQ +  QA  F V   L+SF 
Sbjct: 65  AKIFVGAALMRAAGCAYNDIVDSDIDAKVSRTAGRPIPSGQISLRQAWGFIVACCLVSFG 124

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           LLL   P  I +G A L +   YPF KR    PQ  LG+ F  G  +G+ A     S  A
Sbjct: 125 LLLTMPPLAIGLGVASLALVAAYPFMKRITWWPQAWLGLTFNWGALLGYAAAAGELSLAA 184

Query: 188 FFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY 237
             L    IFW + +DT+YA QD +DD L GV S+AR         + + Y
Sbjct: 185 GLLYAAGIFWTLGYDTIYAVQDLEDDALAGVKSSARRLGSGVGRGVLVFY 234


>gi|290476969|ref|YP_003469880.1| p-hydroxybenzoate octaprenyltransferase [Xenorhabdus bovienii
           SS-2004]
 gi|289176313|emb|CBJ83118.1| p-hydroxybenzoate octaprenyltransferase [Xenorhabdus bovienii
           SS-2004]
          Length = 288

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 90/287 (31%), Positives = 137/287 (47%), Gaps = 17/287 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R +   G  L + P  W+  +AA  +            + L ++ +G    R A 
Sbjct: 13  YCRLMRINKPIGVLLLLWPTYWALWIAAKGMPD---------LYILLVFTIGVYTMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D   D  V RT+SRPLPSG  +  ++ +  V   LISF L+L  N   I + F
Sbjct: 64  CCINDFADRKFDGHVERTKSRPLPSGDVSEKESKILFVTLGLISFALVLTLNKMTIALSF 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++ +YPF KR    PQ+VLG  +   + + + A+  S     + L +  I W V +
Sbjct: 124 IGLALAWVYPFVKRVSNLPQIVLGAAYGWSIPMAFAAVSESLPLECWLLFLVNIIWSVIY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    KL L IL  I +   +   C++ +    +  L
Sbjct: 184 DTQYAMVDRDDDLKIGVKSTAVLFGRFDKLILGILQFIMLGILVSVGCIVNLGGMYYWTL 243

Query: 262 LIA--LFLTIKRIIALDISCSKQ--CCSFFHSAGVVGILILICLIIS 304
           L+A  LF+  +++    IS  K+  C   F +   VG ++ + ++ S
Sbjct: 244 LLAGSLFIYQQKL----ISGRKKALCFQAFMNNNYVGFILFLGILFS 286


>gi|327396071|dbj|BAK13493.1| 4-hydroxybenzoate octaprenyltransferase UbiA [Pantoea ananatis
           AJ13355]
          Length = 288

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 134/286 (46%), Gaps = 15/286 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  LA   +    +L          +++ G  V R A 
Sbjct: 7   YSRLMRIDKPIGALLLLWPTLWALWLAKMAVPPLHILA---------VFVAGVFVMRAAG 57

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT+ RPL SG  T  +A    V+  LI+F L+L  N   I +  
Sbjct: 58  CVINDYADRKVDGHVERTKHRPLASGAVTAKEAKYLFVVLGLIAFALVLSMNLMTIMLSV 117

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++ +YPF KR+   PQVVLG  F   + + W A+  S     + + +  I W V +
Sbjct: 118 VGLALAWVYPFMKRYTHLPQVVLGAAFGWAIPMAWSAVSESLPLVCWLVFLANICWTVAY 177

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFMVAFCLLTVNFFAWIG 260
           DT YA  D+ DD  IGV STA LF    K  + +L  G  VL   V   L     F W  
Sbjct: 178 DTQYAMVDRDDDLKIGVKSTAILFGRYDKFIIGLLQLGTLVLMAWVGMILDLNGAFYWTL 237

Query: 261 LLI-ALFLTIKRIIALDISCSKQCC-SFFHSAGVVGILILICLIIS 304
           LL   LF+  +++IA      +Q C   F +   VG+++ + ++++
Sbjct: 238 LLAGGLFVYQQKLIA---ERDRQACFRAFLNNNYVGLVLFLGVLMN 280


>gi|309358092|emb|CAP34433.2| CBR-COQ-2 protein [Caenorhabditis briggsae AF16]
          Length = 405

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 98/332 (29%), Positives = 144/332 (43%), Gaps = 47/332 (14%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S I PY+ L R     G  L   PC WS  +A      AG L      + L ++  GA +
Sbjct: 58  SNIKPYLQLMRVDKPIGTWLLYWPCTWSIAMAT----PAGQL---PSLYMLSLFGTGAFL 110

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  NDL D D D QV RT+ RPL  G  +  QA+         S  +LLQ N F 
Sbjct: 111 MRSAGCVINDLWDKDFDKQVERTKLRPLACGLLSEKQAVGLLAGLLSSSLAILLQLNWFS 170

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLG------------------------------- 165
           + VG + + + + YP +KR+   PQ +LG                               
Sbjct: 171 VAVGASSMALVVGYPLAKRYTYWPQFMLGWYLHLLENSSLTQLLSLFHSRFFLIILPNPL 230

Query: 166 ------IGFAGGVFVGWGALHASFSWPA-FFLCIGTIFWVVYFDTVYAHQDKKDDELIGV 218
                 + F  G  +GW AL    S  A F++    + W + +DT+YAHQDK DD +IGV
Sbjct: 231 FSHSTGLTFNWGALLGWAALKGDLSSSAPFWMYAAALQWTLVYDTIYAHQDKADDIMIGV 290

Query: 219 NSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIK-RIIALDI 277
            STA      TK WL   +G+  +  + A  + +   + +   L A    +  +I ++DI
Sbjct: 291 KSTALRLGADTKKWLSA-FGVGTVASLTACGMASDQTWPYYVALAATTAQLGWQIGSVDI 349

Query: 278 SCSKQCCSFFHSAGVVGILILICLIISLFLDQ 309
                C   F S   +GI++   +++S  L +
Sbjct: 350 DNGADCWDKFKSNSWMGIILFTGIVMSTLLKE 381


>gi|27364580|ref|NP_760108.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio vulnificus CMCP6]
 gi|320154983|ref|YP_004187362.1| 4-hydroxybenzoate polyprenyltransferase [Vibrio vulnificus
           MO6-24/O]
 gi|81448785|sp|Q8DD49|UBIA_VIBVU RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|27360699|gb|AAO09635.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio vulnificus CMCP6]
 gi|319930295|gb|ADV85159.1| 4-hydroxybenzoate polyprenyltransferase [Vibrio vulnificus
           MO6-24/O]
          Length = 284

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/154 (38%), Positives = 86/154 (55%)

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           R A C  ND  D  +D  V RT+ RPLPSG+ T  +A++  +L  + SF+L+L  NP  I
Sbjct: 56  RSAGCVINDFADRKVDGHVKRTQQRPLPSGRVTAKEAIILFLLLGISSFLLVLTMNPLTI 115

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFW 197
            + FA + ++ +YPF KR+   PQ+ LG+ F+  + + W A      W  +F+      W
Sbjct: 116 QLSFAGIVLAFIYPFMKRYTHLPQLFLGLAFSWAIPMAWAAQANELPWVVWFVFAINALW 175

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
            + +DT YA  D+ DD  IGV STA LF    KL
Sbjct: 176 TIAYDTQYAMVDRDDDVHIGVKSTAILFGRHDKL 209


>gi|260774819|ref|ZP_05883721.1| 4-hydroxybenzoate polyprenyltransferase [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260609244|gb|EEX35399.1| 4-hydroxybenzoate polyprenyltransferase [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 284

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/165 (36%), Positives = 91/165 (55%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L ++I+G +  R A C  ND  D  +D  V RT  RPLPSG+ T  +A+   ++  + SF
Sbjct: 45  LVVFILGVVFMRSAGCVINDFADRKVDGHVKRTSQRPLPSGRATPKEAIGLFIVLSVASF 104

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+L  NP  I + FA LF++ +YPF KR+   PQ+ LG+ F+  + + W A        
Sbjct: 105 LLVLTMNPLTIKLSFAGLFLAFIYPFMKRYTHLPQLFLGLAFSWSIPMAWAAQANELPAM 164

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
            +F+      W + +DT YA  D+ DD  IG+ STA LF    K+
Sbjct: 165 VWFIFAINALWTIAYDTQYAMVDRDDDLKIGIKSTAILFGRFDKM 209


>gi|237806921|ref|YP_002891361.1| 4-hydroxybenzoate polyprenyl transferase [Tolumonas auensis DSM
           9187]
 gi|259550864|sp|C4L7X6|UBIA_TOLAT RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|237499182|gb|ACQ91775.1| 4-hydroxybenzoate polyprenyl transferase [Tolumonas auensis DSM
           9187]
          Length = 286

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 97/170 (57%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
           F  L I+  G  V R A C  ND  D   D  V RT SRPLP+G+ T  +AL+F +L  L
Sbjct: 45  FSLLLIFTAGVFVMRSAGCVINDYADRKFDGYVKRTASRPLPAGRLTAVRALLFFLLLVL 104

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           I+FVL+ Q N F I +    L ++ +YPF KR    PQVVLG+ F+  + + +GA+    
Sbjct: 105 IAFVLVWQLNQFTIYLSVGGLLLAAIYPFMKRVTSLPQVVLGMAFSWAIPMAYGAVVGQL 164

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
           +   + L +  + W + +DT+YA  D+ DD  IGV STA LF    +L++
Sbjct: 165 TVTTWLLFLANLVWTIAYDTMYAMVDRDDDLKIGVKSTAILFGQNDRLYI 214


>gi|56416970|ref|YP_154044.1| prenyltransferase [Anaplasma marginale str. St. Maries]
 gi|56388202|gb|AAV86789.1| 4-hydroxybenzoate octaprenyltransferase [Anaplasma marginale str.
           St. Maries]
          Length = 299

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 80/219 (36%), Positives = 108/219 (49%), Gaps = 12/219 (5%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R  S     LA  P L S  +A+  + +          W   +  VGA + R A
Sbjct: 17  PYFTLCRLQSVEITLLAAFPALASISIASNSIAKT--------LWLFVLSAVGAAIVRTA 68

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP--FVIC 138
            C  ND+ D  ID++V RT++RPL SG  T  QAL   +L   I+  +LL  N   F + 
Sbjct: 69  GCVINDIFDRKIDAKVRRTKNRPLASGALTVPQALKVLLLLVGIALGILLLTNAMTFYLS 128

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
             FA+  +  LYP  KR+   PQ  LG  F  GV +G           +  L IG IFW 
Sbjct: 129 TFFAVGIV--LYPLMKRYFSYPQFFLGFVFNCGVLIGSAMAANKLVLGSILLYIGCIFWT 186

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY 237
             +DT+YA QDK+DD ++G+ STA  F   TK ++  LY
Sbjct: 187 TAYDTIYACQDKEDDAILGLGSTAVKFGANTKRYIGRLY 225


>gi|156847452|ref|XP_001646610.1| hypothetical protein Kpol_1028p25 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156117289|gb|EDO18752.1| hypothetical protein Kpol_1028p25 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 395

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 91/295 (30%), Positives = 135/295 (45%), Gaps = 12/295 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L  LP  W+  +AA  ++ +  LG  +  W L ++ VG++V RGA
Sbjct: 105 PYAELMRLEKPVGTWLLYLPGTWAITMAA--MQTSATLG--STVWMLALFGVGSLVMRGA 160

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL D ++D +V+R+  RP+ SG+ ++ +A+ F   Q  +   +L Q       +G
Sbjct: 161 GCTINDLCDRNLDDKVIRSVERPIASGRVSQKKAIAFLGAQTAVGMGVLTQLPANCWWLG 220

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTIFWVV 199
            A L I   YP  KRF   PQ+ L   F     +G+ A+     W     L   +  W +
Sbjct: 221 LASLPIVFTYPLFKRFTYYPQIALSACFNWAALLGFPAM-GIMDWSTMIPLYTSSFLWCM 279

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTK----LWLFILYGIFVLCFMVAFCLLTVNF 255
            +DT+YAHQDKK D   G+ STA  +  +TK        I +G   +  + +  +L   F
Sbjct: 280 IYDTIYAHQDKKFDIKAGIKSTALAWGDKTKTICNTLATIQFGSLAIAGINSGLILGPGF 339

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
               GL I  +     I  +D+   K C   F S    G+     LI    L  F
Sbjct: 340 IG--GLTIFAYRVFTMIKNVDLDNPKDCWKAFISNIDTGLYFSYALIFDYLLKLF 392


>gi|15892972|ref|NP_360686.1| prenyltransferase [Rickettsia conorii str. Malish 7]
 gi|15620168|gb|AAL03587.1| 4-hydroxybenzoate octaprenyltransferase [Rickettsia conorii str.
           Malish 7]
          Length = 282

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 138/273 (50%), Gaps = 12/273 (4%)

Query: 27  RWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWND 86
           R      + L   P L+  +LA  P R       + +   L ++I+G+I  R + C  ND
Sbjct: 15  RADKLVAYLLVFFPALFGLLLAN-PSR-------TELIHLLPLFILGSITARSSGCIIND 66

Query: 87  LVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF-ALLF 145
           + D   D  V RT+ RPL S   +   A++   +  +IS  +LL  N   I +GF A++ 
Sbjct: 67  IFDRKFDKHVARTKERPLASKALSVSYAILILFILSVISLCILLLLNKTAIYIGFFAVIM 126

Query: 146 ISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVY 205
           ISL YP  KR    PQ+ LG  F  G  + + A+  +    A  + +   FW + +DT+Y
Sbjct: 127 ISL-YPLMKRITYFPQIFLGFTFKLGALIAYAAVQDTLDIAAIIMYLACCFWAIGYDTIY 185

Query: 206 AHQDKKDDELIGVNS-TARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIA 264
            + D +DD+ IGV S +  L +  +KLWL+I Y  F+L F++A  +   N   ++ +L A
Sbjct: 186 GYMDIRDDKKIGVKSLSIYLENKHSKLWLYICYIGFILLFILATKMANHN-IDYLPILAA 244

Query: 265 LFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
           L L I ++  LDI     C + F +   +G+++
Sbjct: 245 LILLILQVATLDIENPANCMTRFRANNYIGLVL 277


>gi|254995148|ref|ZP_05277338.1| 4-hydroxybenzoate polyprenyltransferase [Anaplasma marginale str.
           Mississippi]
          Length = 299

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 80/219 (36%), Positives = 108/219 (49%), Gaps = 12/219 (5%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R  S     LA  P L S  +A+  + +          W   +  VGA + R A
Sbjct: 17  PYFTLCRLQSVEITLLAAFPALASISIASNSIAKT--------LWLFVLSAVGAAIVRTA 68

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP--FVIC 138
            C  ND+ D  ID++V RT++RPL SG  T  QAL   +L   I+  +LL  N   F + 
Sbjct: 69  GCVINDIFDRKIDAKVRRTKNRPLASGALTVPQALKVLLLLVGIALGILLLTNAMTFYLS 128

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
             FA+  +  LYP  KR+   PQ  LG  F  GV +G           +  L IG IFW 
Sbjct: 129 TFFAVGIV--LYPLMKRYFSYPQFFLGFVFNCGVLIGSAMAANKLVLGSILLYIGCIFWT 186

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY 237
             +DT+YA QDK+DD ++G+ STA  F   TK ++  LY
Sbjct: 187 TAYDTIYACQDKEDDAILGLGSTAVKFGANTKRYIGRLY 225


>gi|70733389|ref|YP_263164.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas fluorescens
           Pf-5]
 gi|118574214|sp|Q4K3L9|UBIA_PSEF5 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|68347688|gb|AAY95294.1| 4-hydroxybenzoate polyprenyl transferase [Pseudomonas fluorescens
           Pf-5]
          Length = 296

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/199 (32%), Positives = 106/199 (53%)

Query: 66  YLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLIS 125
           ++ I+  G ++TR   C  ND  D  +D QV RT  RPL +G+ +  +AL+   +    +
Sbjct: 54  HVLIFTFGVVLTRAGGCAINDFADRKVDGQVKRTDQRPLATGKVSAKEALILFAVLMGAA 113

Query: 126 FVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW 185
           F+L+L  N   + + F  L ++  YPF KR+   PQVVLG  ++ G+ + + A +     
Sbjct: 114 FLLVLCTNATTVWLSFGALALAACYPFMKRYTYYPQVVLGAAYSWGILMTFTAQNGELPA 173

Query: 186 PAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFM 245
            A+ L I  + W V +DT YA  D+ DD  IGV STA LF    ++ +  L G+ + C +
Sbjct: 174 TAWLLYIANLLWTVGYDTYYAMTDRDDDLKIGVKSTAILFGDADRVIILTLQGLSLGCLL 233

Query: 246 VAFCLLTVNFFAWIGLLIA 264
           +A     +  +  +GL +A
Sbjct: 234 LAGARFNLGGWFHLGLAVA 252


>gi|81300773|ref|YP_400981.1| 4-hydroxybenzoate polyprenyltransferase [Synechococcus elongatus
           PCC 7942]
 gi|81169654|gb|ABB57994.1| 4-hydroxybenzoate octaprenyltransferase [Synechococcus elongatus
           PCC 7942]
          Length = 310

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 117/243 (48%), Gaps = 21/243 (8%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           + L RW    G  + +LP LW+ VLA+         G    F  +++ I G +    A C
Sbjct: 33  IRLLRWDKPAGRLILLLPALWAVVLAS---------GGRPDFGLIWLIICGGLAASAAGC 83

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFA 142
             NDL D ++D +V RT+ RPL S + +     + A++  L ++ L     P    +  A
Sbjct: 84  VINDLWDRNLDPRVERTKQRPLASRRLSTRVGAIAAIVSLLAAWGLAQFLTPLGYWLCVA 143

Query: 143 LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFD 202
            + + +LYP +KR    PQ+VL I +   V + W A+    +W A  L   T+FW + FD
Sbjct: 144 AVPVIVLYPGAKRVFPVPQLVLAIAWGFSVLISWAAVQGELTWAAIALWAATLFWTLGFD 203

Query: 203 TVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLL 262
           TVYA  D++DD  +G+ S+AR F            G      + A  LLT  F AW G L
Sbjct: 204 TVYALADREDDIQVGIQSSARFF------------GDLAPLAIAACYLLTSLFLAWTGAL 251

Query: 263 IAL 265
           + L
Sbjct: 252 LNL 254


>gi|171464092|ref|YP_001798205.1| 4-hydroxybenzoate polyprenyl transferase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|254790281|sp|B1XRV6|UBIA_POLNS RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|171193630|gb|ACB44591.1| 4-hydroxybenzoate polyprenyl transferase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 287

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/251 (29%), Positives = 122/251 (48%), Gaps = 4/251 (1%)

Query: 55  AGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA 114
           +GVL  S     L I++ G  + R A C  ND  D D D  V RT+ RP+ SG+ +  +A
Sbjct: 38  SGVLDLSI----LLIFVAGTFLMRSAGCAINDYADRDFDRHVKRTQGRPVTSGKISAKEA 93

Query: 115 LVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFV 174
           +  A    L +F+L+   N F   +    L ++ +YPF+KRF   PQ VLGI F  G+ +
Sbjct: 94  VAVASFLALCAFLLIQPLNAFTKQLSVLALLVAFIYPFTKRFFAMPQTVLGIAFGFGIPM 153

Query: 175 GWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLF 234
            + A+       A+FL  G IFW + +DT YA  D+ DD  +G+ ++A  F     + + 
Sbjct: 154 AYAAILDFIPLEAWFLFTGNIFWAIAYDTAYAMVDRDDDLRLGLRTSAITFGQYDVVVIA 213

Query: 235 ILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVG 294
           I YG+  L  +    L  ++ +  +G   AL   I  +  +     + C   F     +G
Sbjct: 214 ISYGMLFLSHLWVAQLANLSNYFLVGWFAALACAIYHLKLVSTRNRENCFKAFRHNNWLG 273

Query: 295 ILILICLIISL 305
             + + +++ L
Sbjct: 274 GFLFLGIVLGL 284


>gi|163803398|ref|ZP_02197273.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio sp. AND4]
 gi|159172802|gb|EDP57647.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio sp. AND4]
          Length = 284

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 85/288 (29%), Positives = 141/288 (48%), Gaps = 19/288 (6%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P +W+ V+AA      G+  W+ +     ++++G  + R A 
Sbjct: 9   YWQLMRMDRPIGSLLLLWPTVWALVIAA-----QGLPSWNVLV----VFVLGVFLMRSAG 59

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT+ RPLPSG+ T  +A+   ++  + +F+L+L  NP  I + F
Sbjct: 60  CVINDFADRKVDGHVKRTKQRPLPSGKVTSKEAIGLFLVLGISAFLLVLTMNPLTIKLSF 119

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             +F++ +YPF KR+   PQ+ LG+ F+  + + W A      W  +F+      W + +
Sbjct: 120 TGIFLAFIYPFMKRYTHLPQLFLGLAFSWAIPMAWAAQTGELPWIVWFVFAINALWTIAY 179

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF-----F 256
           DT YA  D+ DD  IG+ STA LF    KL +    G   L  +    LL  ++     +
Sbjct: 180 DTQYAMVDRDDDLKIGIKSTAILFGRYDKLAI----GALQLMTLAMLVLLGQHYGLGQSY 235

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            W  +L+A  L + +   +       C   F +   VG++I + L+I+
Sbjct: 236 YWT-ILVAASLFVYQQHLIRHRERDLCFKAFLNNNYVGMVIAVGLLIA 282


>gi|323492934|ref|ZP_08098074.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio brasiliensis LMG
           20546]
 gi|323312827|gb|EGA65951.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio brasiliensis LMG
           20546]
          Length = 284

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/166 (39%), Positives = 93/166 (56%), Gaps = 2/166 (1%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQAL-VFAVLQFLIS 125
           L ++I+G I  R A C  ND  D  +D  V RT+ RPLPSG+ T  +AL +FAVL  + S
Sbjct: 45  LLVFILGVIFMRAAGCVINDFADRKVDGHVKRTKQRPLPSGRVTSKEALALFAVLA-VSS 103

Query: 126 FVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW 185
           FVL+L  N   I + F  +F++ +YPF KRF   PQ+ LG+ F+  + + W A       
Sbjct: 104 FVLVLSMNTLTIQLSFVGIFLAFIYPFMKRFTHLPQLFLGLAFSWSIPMAWAAQANEVPM 163

Query: 186 PAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
             +F+      W + +DT YA  D+ DD  IG+ STA LF    K+
Sbjct: 164 MVWFIFAINALWTIAYDTQYAMVDRDDDLKIGIKSTAILFGRFDKM 209


>gi|91786384|ref|YP_547336.1| 4-hydroxybenzoate octaprenyltransferase [Polaromonas sp. JS666]
 gi|118574211|sp|Q12GA4|UBIA_POLSJ RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|91695609|gb|ABE42438.1| 4-hydroxybenzoate octaprenyltransferase [Polaromonas sp. JS666]
          Length = 286

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 113/201 (56%), Gaps = 9/201 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L RW+   GW L + P L +  +A++     G  GW      L ++ +G I+ R A 
Sbjct: 9   YLALIRWNRPAGWLLLLWPTLSALWVASH-----GFPGWH----LLTVFTLGTILMRSAG 59

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND+ D D D  V RT  RP+ SGQ +  +ALV   +  L++F L+L  N   I   F
Sbjct: 60  CCVNDVADRDFDRHVKRTAQRPVTSGQVSVREALVLGAVLALLAFGLVLTTNAATIAWSF 119

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++L YPF+KR++  PQ VLG+ F+ G+ + + A+ +     A+ L +G + WV+ +
Sbjct: 120 AALAVTLAYPFAKRYVSMPQAVLGVAFSFGIPMAFAAVQSRVPLLAWVLLLGNLCWVIAY 179

Query: 202 DTVYAHQDKKDDELIGVNSTA 222
           DT YA  D+ DD  IG+ ++A
Sbjct: 180 DTEYAMVDRDDDLKIGMKTSA 200


>gi|118602129|ref|YP_903344.1| 4-hydroxybenzoate octaprenyltransferase [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
 gi|118567068|gb|ABL01873.1| 4-hydroxybenzoate octaprenyltransferase [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
          Length = 273

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 108/205 (52%), Gaps = 9/205 (4%)

Query: 27  RWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWND 86
           R     G +L + P LW+  LAA      GV         L I+++G I+ R A C  ND
Sbjct: 2   RLDKPIGIYLLLWPTLWALFLAA-----EGVPDLK----LLLIFVLGVILMRSAGCVIND 52

Query: 87  LVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFI 146
             D  +D  + RT+ RP+ SG+     AL   VL  +++F+L+L  N   I +      +
Sbjct: 53  YADRHVDKLIKRTKQRPITSGEINHKSALKLFVLLIMLAFILVLLTNWLTIQLAMIAALL 112

Query: 147 SLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYA 206
           ++LYPF+KR+   PQ VLG+ FA  V + + A   +    A ++   T+ W V +DT+YA
Sbjct: 113 AILYPFTKRWTHFPQFVLGLAFAMSVPMAFSATLNTIPTTALYVFAATVIWTVIYDTMYA 172

Query: 207 HQDKKDDELIGVNSTARLFSYQTKL 231
             D+++D  IGV STA LF+   +L
Sbjct: 173 MADREEDLKIGVKSTAILFAKFDRL 197


>gi|37678305|ref|NP_932914.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio vulnificus YJ016]
 gi|81758717|sp|Q7MQ87|UBIA_VIBVY RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|37197044|dbj|BAC92885.1| 4-hydroxybenzoate polyprenyltransferase [Vibrio vulnificus YJ016]
          Length = 284

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/154 (38%), Positives = 86/154 (55%)

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           R A C  ND  D  +D  V RT+ RPLPSG+ T  +A++  +L  + SF+L+L  NP  I
Sbjct: 56  RSAGCVINDFADRKVDGHVKRTQQRPLPSGRVTAKEAVILFLLLGISSFLLVLTMNPLTI 115

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFW 197
            + FA + ++ +YPF KR+   PQ+ LG+ F+  + + W A      W  +F+      W
Sbjct: 116 QLSFAGIVLAFIYPFMKRYTHLPQLFLGLAFSWAIPMAWAAQANELPWVVWFVFAINALW 175

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
            + +DT YA  D+ DD  IGV STA LF    KL
Sbjct: 176 TIAYDTQYAMVDRDDDIQIGVKSTAILFGRHDKL 209


>gi|40253783|dbj|BAD05721.1| putative PGT-2 [Oryza sativa Japonica Group]
          Length = 256

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 97/169 (57%), Gaps = 3/169 (1%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L ++  G+++ RGA CT NDL+D DID +V RT+SRPL SG  T  Q + F   Q L+  
Sbjct: 14  LALFACGSVLIRGAGCTINDLLDRDIDRKVERTKSRPLASGILTPTQGVGFLGFQLLLGL 73

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
            +LLQ N     +G   L +   YP  KRF   PQ  LG+ F  G  +GW A+  +   P
Sbjct: 74  PILLQLNNLSQILGVFSLLLVFSYPLMKRFTYWPQAYLGLVFNWGALIGWAAMKGTID-P 132

Query: 187 AFFLCIGT--IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
           A  L + T  I W + +DT+YAHQDK+DD  +GV STA  F   TK W+
Sbjct: 133 AIILPLYTAGICWTLVYDTIYAHQDKEDDVKVGVKSTALRFGDSTKPWI 181


>gi|269958616|ref|YP_003328403.1| prenyltransferase [Anaplasma centrale str. Israel]
 gi|269848445|gb|ACZ49089.1| prenyltransferase [Anaplasma centrale str. Israel]
          Length = 309

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 80/219 (36%), Positives = 108/219 (49%), Gaps = 12/219 (5%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R  S     LA  P L S  +A+  + +          W   +  VGA + R A
Sbjct: 27  PYFTLCRLQSVEITLLAAFPALASISIASNSIAKT--------LWLFVLSAVGAAIVRTA 78

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP--FVIC 138
            C  ND+ D  ID++V RT++RPL SG  T  QAL   +L   I+  +LL  N   F + 
Sbjct: 79  GCVINDIFDRKIDAKVRRTKNRPLASGALTVPQALKVLLLLVGIALGILLLTNAMTFYLS 138

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
             FA+  +  LYP  KR+   PQ  LG  F  GV +G           +  L IG IFW 
Sbjct: 139 TFFAVGIV--LYPLMKRYFSYPQFFLGFVFNCGVLIGSAMAANKLVLGSILLYIGCIFWT 196

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY 237
             +DT+YA QDK+DD ++G+ STA  F   TK ++  LY
Sbjct: 197 TAYDTIYACQDKEDDAILGLGSTAVKFGANTKRYIGRLY 235


>gi|50285815|ref|XP_445336.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49524640|emb|CAG58242.1| unnamed protein product [Candida glabrata]
          Length = 363

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 85/280 (30%), Positives = 137/280 (48%), Gaps = 12/280 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L  LP  W+ ++AA  +  +  LG  +  W L ++ VG+++ RGA
Sbjct: 73  PYAELMRLEKPVGTWLLYLPGSWAIIMAA--METSASLG--STAWMLGLFGVGSLIMRGA 128

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL+D ++D++V+R+  RP+ +G+ +   A++F   Q  +   +L Q       +G
Sbjct: 129 GCTINDLLDRNLDNKVIRSVERPIAAGRVSPKNAVLFLGAQTAVGMGILTQLPAQCWWLG 188

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTIFWVV 199
            A L I   YP  KRF   PQ  L   F  G  +G+ A+  + +W A   L +G+  W +
Sbjct: 189 LASLPIVFTYPLFKRFTYYPQAALSACFTWGALLGYPAMGLT-NWSAMIPLYVGSFLWCM 247

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFIL----YGIFVLCFMVAFCLLTVNF 255
            +DT+YAHQDK  D   G+ STA  +  +TK     +    + ++ L  + +       F
Sbjct: 248 TYDTIYAHQDKMFDIKAGIKSTALAWGDKTKAICNTMSVAQFSLYALAGINSGLFWGPGF 307

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGI 295
               GL +  +   K I  +D++  K C   F S    G+
Sbjct: 308 IG--GLSLFAYRVFKMIRTVDLNNPKDCWKHFISNINTGL 345


>gi|145589966|ref|YP_001156563.1| 4-hydroxybenzoate polyprenyl transferase [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|189036997|sp|A4SZT5|UBIA_POLSQ RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|145048372|gb|ABP34999.1| 4-hydroxybenzoate octaprenyltransferase [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 287

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 103/191 (53%), Gaps = 1/191 (0%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L I+I G  + R A C  ND  D D D  V RT+ RP+ SG+ +  +A+V A +  LI+F
Sbjct: 46  LMIFIAGTFLMRSAGCAINDYADRDFDRHVQRTKHRPVTSGKISGKEAVVVAGVLALIAF 105

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+   N F   +    L ++ +YPF+KRF+  PQ VLGI F  G+ + + A+       
Sbjct: 106 LLIQPLNIFTKELSVLALLVAFIYPFTKRFLAIPQAVLGIAFGFGIPMAYAAVLDFIPLE 165

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGI-FVLCFM 245
           A+ L +G IFW + +DT YA  D+ DD  +G+ ++A  F     L +   YG+ FV    
Sbjct: 166 AWVLFVGNIFWAIAYDTAYAMVDRDDDLRLGLRTSAITFGSYEVLAIAFSYGVLFVSQLW 225

Query: 246 VAFCLLTVNFF 256
           VA      N+F
Sbjct: 226 VAHLASLSNYF 236


>gi|87198973|ref|YP_496230.1| prenyltransferase [Novosphingobium aromaticivorans DSM 12444]
 gi|87134654|gb|ABD25396.1| 4-hydroxybenzoate octaprenyltransferase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 304

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/231 (33%), Positives = 113/231 (48%), Gaps = 11/231 (4%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           LAR+    GW L   PC W   L        G   W  + W L     GAI  RGA C +
Sbjct: 32  LARFDRPIGWWLLFWPCAWGLFLGG------GTSRWGILAWMLL----GAIAMRGAGCVY 81

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND+VD D+D++V+RT +RP+ SG  ++  A ++ +    +  V+LLQ       V    L
Sbjct: 82  NDIVDADLDARVVRTAARPVASGATSKRAAWIWLLTLCAVGLVVLLQLRREAQLVAIGSL 141

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGW-GALHASFSWPAFFLCIGTIFWVVYFDT 203
            +   YPF KR    PQ  LG+ F  G  VGW  A       P   L  G   W + +DT
Sbjct: 142 ALVAAYPFMKRITGWPQAWLGLVFTWGAPVGWVEATGFDRLGPLAALYAGCWAWCMAYDT 201

Query: 204 VYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
           +YA QD++DD ++G+ S+A  F    +  +  LY + +LC+  A  L+  +
Sbjct: 202 IYALQDREDDAMVGIGSSALSFGSYVRAGVGGLYAMALLCWAGAVWLVRAD 252


>gi|121592812|ref|YP_984708.1| 4-hydroxybenzoate octaprenyltransferase [Acidovorax sp. JS42]
 gi|222109591|ref|YP_002551855.1| 4-hydroxybenzoate polyprenyl transferase [Acidovorax ebreus TPSY]
 gi|189036979|sp|A1W307|UBIA_ACISJ RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790265|sp|B9MBT5|UBIA_DIAST RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|120604892|gb|ABM40632.1| 4-hydroxybenzoate octaprenyltransferase [Acidovorax sp. JS42]
 gi|221729035|gb|ACM31855.1| 4-hydroxybenzoate polyprenyl transferase [Acidovorax ebreus TPSY]
          Length = 290

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 138/290 (47%), Gaps = 21/290 (7%)

Query: 17  SAIAP------YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIY 70
           SA+AP      Y+ L RW+   GW + V P L +  +AA      G  GW      L ++
Sbjct: 2   SAVAPRSRLSLYLDLIRWNRPAGWLVLVWPTLAALWVAA-----DGFPGWH----LLAVF 52

Query: 71  IVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLL 130
           + G ++ R A CT ND+ D D D  V RT  RP+ SGQ    +A +  V+  L++FVL+L
Sbjct: 53  VAGTVLMRSAGCTINDIADRDFDRHVKRTTQRPITSGQLGVREAALVGVVLTLVAFVLVL 112

Query: 131 QFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFL 190
                 +      +  ++LYPF+KRF   PQ  LGI F  G+ + + A+       A+ L
Sbjct: 113 TTRWEAVAWSVPAVLFTILYPFTKRFFAMPQAFLGIAFNFGIVIAFAAVQGRVPATAWVL 172

Query: 191 CIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCL 250
            +  +F V+ +DT YA  D+ DD  IG+ ++A       +  +  + G FVLC  +   +
Sbjct: 173 WLANLFLVLAYDTEYAMVDRDDDLKIGMKTSAITLG---RFDVAAIMGFFVLCLGLTAWV 229

Query: 251 LT---VNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
           L    + +  W+GL +A          +     + C + F  +  +G  I
Sbjct: 230 LAPYGLGWPLWLGLGVAAAQVAWHFTLIKDRTREGCFTAFSKSHWIGAAI 279


>gi|296116283|ref|ZP_06834899.1| 4-hydroxybenzoate polyprenyl transferase [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295977102|gb|EFG83864.1| 4-hydroxybenzoate polyprenyl transferase [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 319

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 88/274 (32%), Positives = 128/274 (46%), Gaps = 11/274 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAA--YPLRRAGVLGWSTIFWYLFIYIVGA 74
           + + PY  LAR     G  L  LP +W  +L A   P  R            + ++ +G+
Sbjct: 32  APLRPYALLARLDRPIGTWLLFLPGVWGILLPADVAPRER---------LRLIVLFGIGS 82

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
           IV R A C  ND+ D DID  V RT  RPL SG     +A +F +   LI F +L+  NP
Sbjct: 83  IVMRAAGCVVNDMWDRDIDRMVARTAGRPLASGALRMREAGLFLLALLLIGFNILMCLNP 142

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT 194
               +G + L +  LYP +KR    PQ+V+G  F  G  +G+ A           L   T
Sbjct: 143 LSRALGASSLLLVALYPLAKRVTWWPQLVMGFTFGFGAPLGYAAAADRIDLAQGALYAAT 202

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
           I W + FDT+Y  QD +DD  IGV ST+RL + + + ++   Y + +     A  L    
Sbjct: 203 IVWQLGFDTIYGFQDMEDDARIGVKSTSRLMARRARGFVGTCYALALAGIAAAAVLSHQG 262

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFH 288
           +  W GL +   L   +++ LD   + QC   F 
Sbjct: 263 WGFWAGLPVPAALLTWQVMRLDEHDAPQCLRLFR 296


>gi|332171787|gb|AEE21041.1| 4-hydroxybenzoate polyprenyl transferase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 280

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 140/280 (50%), Gaps = 15/280 (5%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           L R     G +L + P LW+ ++AA      G+  W    W   I++ G  V R A C  
Sbjct: 7   LMRADKPVGSYLLLWPTLWALMIAA-----QGLPPW----WITAIFVAGVFVMRSAGCVI 57

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND  D  +D +V RT +RPL SG  T  QAL        ++F+L+L  N   I +    L
Sbjct: 58  NDYADRKVDGKVARTNARPLVSGVVTEKQALGLFATLVGVAFLLVLALNWQTIVLSIGAL 117

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            ++ +YPF KR+   PQVVLG  FA  + + + A++ +    A++L    + W V +DT 
Sbjct: 118 GLAAVYPFMKRYTHLPQVVLGAAFAWAIPMAFMAVNEAVPGIAWWLFSINVLWTVAYDTE 177

Query: 205 YAHQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFMVA-FCLLTVNFFAWIGLL 262
           YA  D+ DD  IGV STA LF    +L + +L   + V+ F +  +   T+ F+  + + 
Sbjct: 178 YAMVDRNDDLQIGVKSTAILFGQYDRLIIGLLQLSVVVMLFALGQYLHFTLPFYLGVLVA 237

Query: 263 IALFLTIKRIIALDISCSKQCC-SFFHSAGVVGILILICL 301
           + LF   +R+I       +Q C + F +   VG+ I I +
Sbjct: 238 VVLFAYQQRLI---YERDRQACFTAFLNNNYVGMAIAIGI 274


>gi|120609296|ref|YP_968974.1| 4-hydroxybenzoate octaprenyltransferase [Acidovorax citrulli
           AAC00-1]
 gi|189036978|sp|A1TJR2|UBIA_ACIAC RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|120587760|gb|ABM31200.1| 4-hydroxybenzoate octaprenyltransferase [Acidovorax citrulli
           AAC00-1]
          Length = 295

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 110/206 (53%), Gaps = 9/206 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S +A Y+ L RW    GW L + P L +  +AA      G  GW      L ++ +G I+
Sbjct: 13  SRLALYLDLIRWSRPAGWLLLLWPTLSALWIAA-----GGFPGWH----LLAVFTLGTIL 63

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  ND+ D D D  V RT  RP+ SG  +  +AL    +  L+SF L+L  N   
Sbjct: 64  MRSAGCCVNDVADRDFDRHVKRTAQRPVTSGAVSVREALGVGAVLALVSFGLVLTTNAAT 123

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I      L +++ YPF+KRF+  PQ VLG+ F+ G+ + + A+  +    A +L +G + 
Sbjct: 124 IAWSLPALAVTIAYPFAKRFVSMPQAVLGVAFSMGIPMAFTAVGGAVPMLAAWLVLGNLC 183

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTA 222
           WV+ +DT YA  D+ DD  IG+ ++A
Sbjct: 184 WVLAYDTEYAMVDRDDDLKIGMKTSA 209


>gi|254360769|ref|ZP_04976917.1| 4-hydroxybenzoate octaprenyltransferase [Mannheimia haemolytica
           PHL213]
 gi|261491706|ref|ZP_05988287.1| 4-hydroxybenzoate octaprenyltransferase [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261494469|ref|ZP_05990955.1| 4-hydroxybenzoate octaprenyltransferase [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|153091339|gb|EDN73313.1| 4-hydroxybenzoate octaprenyltransferase [Mannheimia haemolytica
           PHL213]
 gi|261309853|gb|EEY11070.1| 4-hydroxybenzoate octaprenyltransferase [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261312659|gb|EEY13781.1| 4-hydroxybenzoate octaprenyltransferase [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 291

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 109/211 (51%), Gaps = 10/211 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R+    G  L + P LW+  +AA  +    +L          I+ +G IV R A 
Sbjct: 15  YAQLMRFDKPIGTLLLLHPTLWALFIAAEGMPPVAILA---------IFTLGVIVMRAAG 65

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D +ID  V RT  RPL +G+ T  +A V   +  L +F+L L  N +   + F
Sbjct: 66  CVINDYADREIDGHVKRTSQRPLATGRVTTTEAKVIFAILLLFAFLLDLMLNRYAFLLSF 125

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             +F++++YPF KRF   PQVVLG+ F   + + +GA+  +     + L    + W V +
Sbjct: 126 VAVFLAVIYPFMKRFTHLPQVVLGMAFGWSIPMAFGAVTETLPLECWLLFFANLAWTVAY 185

Query: 202 DTVYAHQDKKDDELIGVNSTARLFS-YQTKL 231
           DT YA  D+ DD  IGV STA LF+ Y  K+
Sbjct: 186 DTQYAMVDRDDDLRIGVKSTAILFAQYDNKI 216


>gi|119896770|ref|YP_931983.1| 4-hydroxybenzoate octaprenyltransferase [Azoarcus sp. BH72]
 gi|189036984|sp|A1K2P1|UBIA_AZOSB RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|119669183|emb|CAL93096.1| 4-hydroxybenzoate octaprenyltransferase [Azoarcus sp. BH72]
          Length = 287

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 83/239 (34%), Positives = 117/239 (48%), Gaps = 21/239 (8%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  LAA                 L I+ +G ++ R A 
Sbjct: 10  YGRLMRLDKPIGSLLLLWPTLWALWLAA---------DGKPPLHVLVIFTIGTVLMRSAG 60

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D D D  V RTR+RPL +   +  +AL  A     +SFVL+L  +P VI + F
Sbjct: 61  CVINDYADRDFDGHVERTRNRPLATRAVSTREALALAAGLSALSFVLILPLDPLVIWLSF 120

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             LF++  YPF+KRF   PQ  LGI F  G+ +G+ A+       A+ + +  IFW V +
Sbjct: 121 PALFLAASYPFTKRFFAIPQAYLGIAFGFGIPMGFAAVQGEVPPIAWVMLLANIFWAVAY 180

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           DT YA  D+ DD  IG+ ++A  F        F +  + +LC+ VA  LL      W+G
Sbjct: 181 DTEYAMVDRPDDLKIGIKTSAITFGR------FDVAAV-MLCYAVALGLL-----GWVG 227


>gi|4454035|emb|CAA23032.1| polyprenyltransferase like protein [Arabidopsis thaliana]
 gi|7269214|emb|CAB79321.1| polyprenyltransferase like protein [Arabidopsis thaliana]
          Length = 370

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 88/239 (36%), Positives = 123/239 (51%), Gaps = 25/239 (10%)

Query: 12  DCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYI 71
           D  +   +  Y  LAR     G  L   PC+WS  LAA P       G    F Y+ ++ 
Sbjct: 117 DLYLPEEVRGYAKLARLDKPIGTWLLAWPCMWSIALAADP-------GSLPSFKYMALFG 169

Query: 72  VGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQ 131
            GA++ RGA CT NDL+D DID++V RT+ RP+ SG  T FQ + F  LQ L+   +LLQ
Sbjct: 170 CGALLLRGAGCTINDLLDQDIDTKVDRTKLRPIASGLLTPFQGIGFLGLQLLLGLGILLQ 229

Query: 132 FNPFVICV------GFALLFISLLYPFSKRFILC---------PQVVLGIGFAGGVFVGW 176
            N + + +      GF  +    L  + + +IL          PQ  LG+    G  +GW
Sbjct: 230 LNNYSMYILQPCFRGFIFVTCLFLPTYEEVYILGNLNLFWLLKPQAFLGLTINWGALLGW 289

Query: 177 GALHASFSWPAFFLC--IGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL 233
            A+  S + P+  L   +  + W + +DT+YAHQDK+DD  +GV STA  F   TKLWL
Sbjct: 290 TAVKGSIA-PSIVLPLYLSGVCWTLVYDTIYAHQDKEDDVKVGVKSTALRFGDNTKLWL 347


>gi|320586345|gb|EFW99024.1| para-hydroxybenzoate-polyprenyltransferase [Grosmannia clavigera
           kw1407]
          Length = 377

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 88/276 (31%), Positives = 126/276 (45%), Gaps = 20/276 (7%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R    TG +    PCL+ST++AA P+ +  +     +     ++  GA++ R A
Sbjct: 79  PYAELTRIDKPTGTYYLFFPCLFSTLMAA-PMVQPAMATPGAVAGTSLLFFAGALIMRSA 137

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C+ NDL D ++D  V RTR RPL     T F+ L F   Q L    +L+QF    +  G
Sbjct: 138 GCSINDLWDRNLDPMVARTRHRPLARQAITPFRGLAFTGAQLLAGLGILVQFPTSCLYYG 197

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL------HASFSWPAFFLCIGT 194
              L +   YP  KR    PQ VLG+ F+ G  +G+ AL      + S    A  L    
Sbjct: 198 IPSLALVATYPLMKRVTYYPQFVLGLTFSWGAIMGFPALGVDLLANNSALLAAGLLYSSN 257

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFV-----LCFMVAFC 249
           + W V +D +YAH D KDD   G+ S A     QTK    +L G+ V     L       
Sbjct: 258 VAWTVLYDMIYAHMDIKDDAKAGIKSIALKHDAQTK---SVLTGLAVVQVGLLAAAGIAS 314

Query: 250 LLTVNFFAWI--GLLIALFLTIKRIIALDISCSKQC 283
                FF     G L++L + I+R+   ++   K C
Sbjct: 315 GAGPAFFVGSCGGALVSLGVMIRRV---NLKSVKDC 347


>gi|323965702|gb|EGB61154.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli M863]
 gi|327250384|gb|EGE62097.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli STEC_7v]
          Length = 290

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 84/248 (33%), Positives = 127/248 (51%), Gaps = 14/248 (5%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
            W L +++ G  + R A C  ND  D   D  V RT +RPLPSG  T  +A    V+  L
Sbjct: 46  LWILAVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVL 105

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           ISF+L+L  N   I +  A L ++ +YPF KR+   PQVVLG  F   + + + A+  S 
Sbjct: 106 ISFLLVLTLNTMTILLSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESV 165

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVL 242
               + + +  I W V +DT YA  D+ DD  IG+ STA LF    KL + IL  G+ VL
Sbjct: 166 PLSCWLMFLANILWAVAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLVL 225

Query: 243 CFMVAFCLLTVNFFAW-----IGLLIALFLTIKRIIALDISCSKQCC-SFFHSAGVVGIL 296
             ++      +N   W     I +  ALF+  +++IA   +  ++ C   F +   VG++
Sbjct: 226 MAIIG----ELNGLGWGYYWSILVAGALFVYQQKLIA---NREREACFKAFMNNNYVGLV 278

Query: 297 ILICLIIS 304
           + + L +S
Sbjct: 279 LFLGLAMS 286


>gi|71275497|ref|ZP_00651783.1| 4-hydroxybenzoate polyprenyl transferase, proteobacterial [Xylella
           fastidiosa Dixon]
 gi|71900745|ref|ZP_00682866.1| 4-hydroxybenzoate polyprenyl transferase, proteobacterial [Xylella
           fastidiosa Ann-1]
 gi|170729296|ref|YP_001774729.1| 4-hydroxybenzoate octaprenyltransferase [Xylella fastidiosa M12]
 gi|254790308|sp|B0U2A2|UBIA_XYLFM RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|71163797|gb|EAO13513.1| 4-hydroxybenzoate polyprenyl transferase, proteobacterial [Xylella
           fastidiosa Dixon]
 gi|71729475|gb|EAO31585.1| 4-hydroxybenzoate polyprenyl transferase, proteobacterial [Xylella
           fastidiosa Ann-1]
 gi|167964089|gb|ACA11099.1| hydroxybenzoate octaprenyltransferase [Xylella fastidiosa M12]
          Length = 299

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 131/281 (46%), Gaps = 9/281 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           + + PY  LAR     G+ L + P  W+  LAA      GV  W    W L ++  G  +
Sbjct: 18  NRLDPYWKLARGDRPVGFLLLLWPTWWALWLAA-----DGVPPW----WTLCVFTTGIWL 68

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
           TR A C  ND  D  +D  V RT +RPL +G  +   AL+      LI+F L+L  N   
Sbjct: 69  TRSAGCVINDYTDRWLDPHVERTCTRPLVTGTVSPRNALLMFATLMLIAFGLVLTMNQLT 128

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           + +  A LF+++ YP+ KR+   PQV LG+ F  G+ + + A+       A+ L I  I 
Sbjct: 129 VLLSVAGLFLAMTYPYLKRYTHLPQVYLGLAFGWGIPMAFAAIQGKVPTLAWLLYIANIL 188

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
           W   +DT YA  D+ DD  +G  S A LF+    +   +LY + +L   +     T++  
Sbjct: 189 WTTAYDTWYAMVDRDDDIKMGAKSIAILFAELDLVVQGVLYTLMLLTLCLVGLRATLSHT 248

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
            WI L+ A+ L   + I         C   F     VG+ I
Sbjct: 249 YWISLISAVALIGYQFIIARRREPTACFRAFMHNNWVGMTI 289


>gi|56459375|ref|YP_154656.1| 4-hydroxybenzoate polyprenyltransferase [Idiomarina loihiensis
           L2TR]
 gi|81362305|sp|Q5QUP3|UBIA_IDILO RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|56178385|gb|AAV81107.1| 4-hydroxybenzoate polyprenyltransferase [Idiomarina loihiensis
           L2TR]
          Length = 283

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 122/240 (50%), Gaps = 15/240 (6%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAY---PLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           L R     G +L   P +W+ ++A     PLR             + I+++G  V R A 
Sbjct: 10  LMRADRPIGTYLLAWPTIWALMIAGAGEPPLR------------IVVIFLLGTFVMRSAG 57

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D + D  V RTR RP+P+G+ +  +A++  +    I+F L++Q N   + + F
Sbjct: 58  CVINDFADRNYDGHVRRTRQRPIPAGRISATEAMIGFIALLAIAFGLVMQLNTETVMLSF 117

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
               ++ LYPF KR+   PQ+VLGI F+ G+ + + AL +   + A  L +  I W V +
Sbjct: 118 FAAGVAALYPFCKRWTHLPQIVLGIAFSFGIPMAFTALESDQWFIAGLLFLANILWTVAY 177

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D++DD  IG+ STA LF    +L + +L    +        L+TV  + W+ L
Sbjct: 178 DTEYAMADREDDLKIGLQSTAILFGRFDRLAIGLLQLATLALLGWILHLITVELWVWLAL 237


>gi|220933319|ref|YP_002512218.1| 4-hydroxybenzoate polyprenyl transferase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219994629|gb|ACL71231.1| 4-hydroxybenzoate polyprenyl transferase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 289

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 113/212 (53%), Gaps = 12/212 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R H   G +L + P LW+  +AA         GW  +   LFI++ G ++ R A 
Sbjct: 11  YALLVRLHRPIGIYLLLWPTLWALWIAAE--------GWPHLG-ILFIFVAGVVLMRSAG 61

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQAL-VFAVLQFLISFVLLLQFNPFVICVG 140
           C  ND  D  ID  V RTR RP+ +G+ +  +AL VFAVL  L++FVL+L  N   I + 
Sbjct: 62  CAINDYADRHIDPHVARTRDRPIAAGRVSPKEALAVFAVL-CLVAFVLVLFLNRLTILLS 120

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP-AFFLCIGTIFWVV 199
              + ++  YPF KRF   PQV LG  FA  V + + A    F  P A+ + I  + W V
Sbjct: 121 LVAVLLAASYPFMKRFHHLPQVHLGAAFAWAVPMAFAAQTGEFPPPIAWLIFIAALLWTV 180

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
            +DT YA  D+++D  +GV S+A LF    ++
Sbjct: 181 VYDTFYAMADREEDLKLGVKSSAILFGEADRM 212


>gi|88799153|ref|ZP_01114733.1| 4-hydroxybenzoate octaprenyltransferase [Reinekea sp. MED297]
 gi|88778136|gb|EAR09331.1| 4-hydroxybenzoate octaprenyltransferase [Reinekea sp. MED297]
          Length = 287

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 86/288 (29%), Positives = 139/288 (48%), Gaps = 9/288 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           +A++ Y+ L R     G +L + P L +  LAA  +   G++          I+ +G +V
Sbjct: 4   TALSHYIKLTRLDRPIGTYLLLWPTLAALWLAAQGMPPLGLV---------VIFTLGVLV 54

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  ND  D  ID  V RT +RPL +G  +  +AL+   +  L +FVL++  N   
Sbjct: 55  MRSAGCVINDFADRHIDGHVKRTVARPLATGLVSAREALILFAVLVLTAFVLVMLTNAET 114

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I + F  L ++  YPF KR+   PQVVLG  FA  + + + A         +      + 
Sbjct: 115 IKMSFIALALAAAYPFMKRYTYLPQVVLGAAFAWAIPMAYTAQEVPLQETTWLWFSACVL 174

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
           W V +DT+YA  D+ DD  IGV STA LF    +L + +L  + VL ++       + + 
Sbjct: 175 WTVVYDTLYAMVDRDDDLKIGVRSTAILFGEYDRLMVGLLQAMTVLAWIFVGLQAELGWI 234

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            W+ +L+A  L   +   +       C   F +   VG+++ I LI++
Sbjct: 235 WWLAVLVATGLFGYQQWLIRGRDRDACFRAFLNNHWVGLVLFIALILN 282


>gi|310796786|gb|EFQ32247.1| 4-hydroxybenzoate polyprenyl transferase [Glomerella graminicola
           M1.001]
          Length = 365

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 106/220 (48%), Gaps = 16/220 (7%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAA---YPLRRA-GVLGWSTIFWYLFIYIVGAIV 76
           PY  L R     G +    PCLWST++AA    P+     V+G S +F+       GA +
Sbjct: 58  PYAELTRMDKPAGTYYLFFPCLWSTLMAAPMVAPMASPVSVIGTSLLFFS------GAFI 111

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C+ NDL D  +D  V RT+ RP+  G  T FQ L F   Q L    +LLQF    
Sbjct: 112 MRSAGCSINDLWDRKLDPHVTRTKFRPIARGALTPFQGLAFTGAQLLAGLGILLQFPTSC 171

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL------HASFSWPAFFL 190
           +  G   L +   YP +KR    PQ VLG+ F+ G  +G+ AL      +++    A  L
Sbjct: 172 LFYGIPSLLLVASYPLAKRITYYPQAVLGLTFSWGAMMGFPALGIDLLSNSAALTAAACL 231

Query: 191 CIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
               + W V +D +YAH D KDD   G+ S A     +TK
Sbjct: 232 YSSNVAWTVLYDMIYAHMDIKDDAKAGIKSIALKHDAETK 271


>gi|85708015|ref|ZP_01039081.1| 4-hydroxybenzoate octaprenyltransferase [Erythrobacter sp. NAP1]
 gi|85689549|gb|EAQ29552.1| 4-hydroxybenzoate octaprenyltransferase [Erythrobacter sp. NAP1]
          Length = 303

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 93/282 (32%), Positives = 139/282 (49%), Gaps = 13/282 (4%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           LAR+    GW L + PC++   LA    + A ++GW         +++GAI  RGA C +
Sbjct: 28  LARFDRPIGWWLLLWPCVFGVWLAGAGPQFA-LIGW---------FLLGAIAMRGAGCVY 77

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND+VD  +D+ V RT +RP+ SG+ ++  A  + +   LI  V+LLQ       V  A L
Sbjct: 78  NDIVDAKLDASVARTAARPVASGRVSKKVAWGWLIFLCLIGLVVLLQLRLEAQIVALASL 137

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF-FLCIGTIFWVVYFDT 203
            +   YPF KR    PQ  LG+ F  G+ VGW  L    +W A   +  G I WV+ +DT
Sbjct: 138 ALVAAYPFMKRITWWPQAWLGMVFNWGLLVGWTQLRFD-NWDALAAIYAGCICWVIGYDT 196

Query: 204 VYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLI 263
           +YA QD++DD L+G+ S+A       +  +   Y   V  + +   L   + FA + LL 
Sbjct: 197 IYALQDREDDALVGIKSSALRMGESFRAGIAAFYTATVGLWGLGVWLYRPDIFALLALLP 256

Query: 264 ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILI-CLIIS 304
             F  + ++  LD        + F S    G L+ I C II 
Sbjct: 257 VAFHLMWQVATLDPDDPANPLARFRSNRWAGALMAIACFIIG 298


>gi|322693328|gb|EFY85192.1| para-hydroxybenzoate-polyprenyltransferase Coq2, putative
           [Metarhizium acridum CQMa 102]
          Length = 407

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 108/220 (49%), Gaps = 16/220 (7%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAA---YPLRRAG-VLGWSTIFWYLFIYIVGAIV 76
           PY  L R    TG +    PCL+ST++AA    P+   G V+G S +F+       GA++
Sbjct: 97  PYAELIRIDKPTGTYYLFFPCLFSTLMAAPMVSPMPSVGSVVGTSILFF------SGALI 150

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT NDL D ++D  V RTR RP+     + F  LVF   Q L    +L+QF    
Sbjct: 151 MRGAGCTINDLWDRNLDPHVSRTRLRPIARRAISPFNGLVFTGAQLLAGLGILMQFPAPC 210

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL------HASFSWPAFFL 190
           +  G   L     YP +KR    PQ VLG+ F+ G  +G+ AL      + S    A  L
Sbjct: 211 LFYGIPSLLFVASYPLAKRVTYYPQFVLGLTFSWGAIMGFPALGVDLLSNGSALTAAACL 270

Query: 191 CIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
               I W V +D +YAH D KDD   G+ S A     QTK
Sbjct: 271 YSSNIAWTVLYDMIYAHMDIKDDAKAGIKSIALKHDSQTK 310


>gi|83643659|ref|YP_432094.1| 4-hydroxybenzoate polyprenyl transferase [Hahella chejuensis KCTC
           2396]
 gi|118574206|sp|Q2SNV5|UBIA_HAHCH RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|83631702|gb|ABC27669.1| 4-hydroxybenzoate polyprenyl transferase [Hahella chejuensis KCTC
           2396]
          Length = 300

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 87/286 (30%), Positives = 134/286 (46%), Gaps = 15/286 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L R +   G +L + P LW+  LA+           +     LFI++ G ++ R A 
Sbjct: 22  YIGLTRLNRPIGTYLLLWPTLWALWLASE---------GAPSLKNLFIFVFGVLLMRSAG 72

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  ID  V RT+ RP    Q T  +AL    +   +SF+L+L  N   I +  
Sbjct: 73  CVINDYADRRIDMHVERTKGRPFAQNQVTEKEALTLFGILVGVSFILVLFTNALTIYLSA 132

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR    PQVVLG  FA G+ + + A   +    A+ L   T+ W V +
Sbjct: 133 GALALASTYPFMKRHTYLPQVVLGAAFAWGIPMAFAAELDAVPQQAWLLYTATVVWTVAY 192

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCL---LTVNFFAW 258
           DT+YA  D++DD  IGV STA LF    +     + G+ VL   V F +     +  +  
Sbjct: 193 DTMYAMADREDDLKIGVKSTAILFGEADRA---AVAGLQVLTLGVLFMVGAQHELGVYYQ 249

Query: 259 IGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           + L+I   L + +   +    S+ C   F +   VG  + + L++ 
Sbjct: 250 VSLIIVAVLFVYQQHLIRDRSSQHCFKAFLNNHWVGAAVFLGLVLE 295


>gi|293602553|ref|ZP_06684998.1| 4-hydroxybenzoate polyprenyl transferase [Achromobacter piechaudii
           ATCC 43553]
 gi|292819029|gb|EFF78065.1| 4-hydroxybenzoate polyprenyl transferase [Achromobacter piechaudii
           ATCC 43553]
          Length = 323

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 77/222 (34%), Positives = 109/222 (49%), Gaps = 9/222 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L +LP + + V +A         G       L ++ +GA++ RG 
Sbjct: 45  PYARLCRLDRPIGTWLTLLPAVAALVQSA---------GGLPDLQRLIVFSLGALLMRGI 95

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT ND+ D + D  V RTR RPL SGQ +   A+ F + Q L+   LL   N     + 
Sbjct: 96  GCTVNDMCDRNFDKHVERTRFRPLTSGQLSMKNAVWFLLGQLLVCGSLLFFLNEMSRWLA 155

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A+L    +YP  KR    PQVVLGI F  G+ + W          A  + +G + W V 
Sbjct: 156 LAVLPFVFIYPLCKRVTYWPQVVLGICFNWGMLMAWSDTQNVVPLAAIAMWLGAVLWQVG 215

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVL 242
           +D++YA+ D +DD  +G++STA  F  Q KLW+   Y   VL
Sbjct: 216 YDSIYAYVDVRDDRSLGLHSTAMRFGDQGKLWIGGFYAATVL 257


>gi|317146409|ref|XP_001821488.2| para-hydroxybenzoate-polyprenyltransferase Coq2 [Aspergillus oryzae
           RIB40]
          Length = 346

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 109/222 (49%), Gaps = 22/222 (9%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAA-----YPLRRAGVLGWSTIFWYLFIYIVGAI 75
           PY  L R    TG +    PC +ST+LAA      P +  G +G         +++ GA+
Sbjct: 28  PYAELIRLDKPTGTYYLFFPCAFSTLLAAPMTSSTPFQVLGTMG---------LFLAGAL 78

Query: 76  VTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPF 135
           V RGA CT NDL D ++D  V RT+ RP+     +  +A+VF  +Q L    +LLQF   
Sbjct: 79  VMRGAGCTINDLWDRNLDPHVERTKFRPIARRAVSPRKAVVFTGMQLLAGLGILLQFPTL 138

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL-------HASFSWPAF 188
            +  G   L +   YP +KR    PQ VLG+ F+ G  +G+ AL       H++    A 
Sbjct: 139 CLWYGIPSLLLVTTYPLAKRITYYPQAVLGLTFSWGAMMGFPALGIDLLSNHSALE-SAA 197

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
            L    + W + +D +YAH D KDD   G+ S A    + TK
Sbjct: 198 ALYSSCVAWTILYDMIYAHMDIKDDVAAGIKSIALRHEHNTK 239


>gi|157964836|ref|YP_001499660.1| 4-hydroxybenzoate polyprenyltransferase [Rickettsia massiliae MTU5]
 gi|157844612|gb|ABV85113.1| 4-hydroxybenzoate octaprenyltransferase [Rickettsia massiliae MTU5]
          Length = 296

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 123/231 (53%), Gaps = 4/231 (1%)

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           ++I+G+I  R + C  ND+ D   D  V RT+ RPL S   +   A++   +  +IS  +
Sbjct: 63  LFILGSITARSSGCIINDIFDRKFDKHVARTKERPLASKALSVSYAILILFILSVISLCI 122

Query: 129 LLQFNPFVICVGF-ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           LL  N   I  GF A++ ISL YP  KR    PQ+ LG  F  G  + + A+  +    A
Sbjct: 123 LLLLNKTAIYTGFFAVIMISL-YPLMKRITYFPQIFLGFTFKLGALIAYAAVQDTLDIAA 181

Query: 188 FFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNS-TARLFSYQTKLWLFILYGIFVLCFMV 246
             + +   FW + +DT+Y + D KDD+ IGV S +  L +  +KLWL+I Y  F+L F++
Sbjct: 182 IIMYLACCFWAIGYDTIYGYMDIKDDKKIGVKSLSIYLENKHSKLWLYICYIGFILLFIL 241

Query: 247 AFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
           A  +   N   ++ +L AL L I ++  LDI     C + F +   +G+++
Sbjct: 242 ATKMANHN-IDYLPILAALILLILQVATLDIENPANCMTRFRANNYIGLVL 291


>gi|254491923|ref|ZP_05105102.1| 4-hydroxybenzoate polyprenyl transferase [Methylophaga thiooxidans
           DMS010]
 gi|224463401|gb|EEF79671.1| 4-hydroxybenzoate polyprenyl transferase [Methylophaga thiooxydans
           DMS010]
          Length = 290

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 105/212 (49%), Gaps = 9/212 (4%)

Query: 15  MGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGA 74
           + SAI PYV L R     G  L + P L +  +AA       VL          ++I+G 
Sbjct: 4   LKSAIWPYVTLMRLDRPIGILLLLWPTLGALWIAAEGFPDLTVL---------LVFILGV 54

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
           I+ R A C  ND  D DID +V RT SRPL +GQ     A++  V+  +I+F L+   N 
Sbjct: 55  IIMRSAGCAINDFADRDIDGKVWRTESRPLATGQLQAKHAVILFVVLAIIAFCLVSLLNT 114

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT 194
             I +    + ++  YPF KRF   PQ+ LGI F   + + + A   +    A+ L +  
Sbjct: 115 MTIWLSLVAVLLAASYPFMKRFTHLPQLYLGIAFGWAIPMAFAAQTETIPTIAWLLFLAN 174

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFS 226
           I W   +DT YA  D+ DD L G+ STA LF 
Sbjct: 175 IIWTTVYDTFYAMADRDDDLLAGIKSTAVLFG 206


>gi|86148642|ref|ZP_01066923.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio sp. MED222]
 gi|218710910|ref|YP_002418531.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio splendidus LGP32]
 gi|254790304|sp|B7VMA0|UBIA_VIBSL RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|85833561|gb|EAQ51738.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio sp. MED222]
 gi|218323929|emb|CAV20290.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio splendidus LGP32]
          Length = 284

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 94/168 (55%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
           F  L ++I+G ++ R A C  ND  D  +D  V RT+ RPLPSG  +  +A+V  ++  +
Sbjct: 42  FDVLVVFILGVVLMRSAGCVINDFADRKVDGHVKRTKQRPLPSGLVSSKEAIVLFLVLAV 101

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           +SF+L+L  NP  I + F  + ++ +YPF KRF   PQ+ LG+ F+  + + W A     
Sbjct: 102 VSFLLVLTMNPLTIKLSFIGVGLAFIYPFMKRFTHLPQLFLGLAFSWAIPMAWAAQTNEL 161

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
               +F+ +    W + +DT YA  D+ DD  IG+ STA LF    KL
Sbjct: 162 PSIVWFIFVINALWTIAYDTQYAMVDRDDDLKIGIKSTAILFGRFDKL 209


>gi|21229868|ref|NP_635785.1| 4-hydroxybenzoate octaprenyltransferase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66766745|ref|YP_241507.1| 4-hydroxybenzoate octaprenyltransferase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188989814|ref|YP_001901824.1| 4-hydroxybenzoate octaprenyltransferase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|81307265|sp|Q4UZN6|UBIA_XANC8 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|81797067|sp|Q8PDE8|UBIA_XANCP RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790305|sp|B0RMR4|UBIA_XANCB RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|21111370|gb|AAM39709.1| hydroxybenzoate octaprenyltransferase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572077|gb|AAY47487.1| hydroxybenzoate octaprenyltransferase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167731574|emb|CAP49749.1| 4-hydroxybenzoate octaprenyltransferase [Xanthomonas campestris pv.
           campestris]
          Length = 301

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 77/244 (31%), Positives = 114/244 (46%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
            W LF++  G  +TR A C  ND  D  +D  V RT+SRPL +G  +  +AL   V+  L
Sbjct: 57  LWTLFVFTAGVWLTRSAGCVINDYADRWLDPHVERTKSRPLATGAVSGREALWVFVVLML 116

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           ++F L+L  N   + +    LF++  YP+ KR    PQV LG+ F  G+ +G+ A+  S 
Sbjct: 117 VAFALVLSLNWLTVALSVPGLFLAASYPYLKRHTHLPQVYLGMAFGWGIPMGFAAVQGSV 176

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
              A+ L    I W   +DT YA  D++DD  +G  STA LF     +   +LY +    
Sbjct: 177 PLLAWLLYAANILWATAYDTWYAMVDREDDLRMGSKSTAILFGRYDLIAQGVLYALMFAA 236

Query: 244 FMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLII 303
            ++      ++   W GL IA  L               C   F     VG+ I + +  
Sbjct: 237 LVLVGLRAGLSIAYWAGLGIAALLVAYEFHIARHRERGPCFRAFLHNNWVGLAIFVGIAA 296

Query: 304 SLFL 307
           SL L
Sbjct: 297 SLAL 300


>gi|319796399|ref|YP_004158039.1| 4-hydroxybenzoate polyprenyl transferase [Variovorax paradoxus EPS]
 gi|315598862|gb|ADU39928.1| 4-hydroxybenzoate polyprenyl transferase [Variovorax paradoxus EPS]
          Length = 286

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 87/250 (34%), Positives = 130/250 (52%), Gaps = 11/250 (4%)

Query: 14  IMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVG 73
           ++   +A Y+ L RW+   GW L + P L +   AA      G  GW  +     ++ +G
Sbjct: 1   MLARRLALYLDLIRWNRPAGWLLLLWPTLGALWFAA-----DGWPGWHLVV----VFTLG 51

Query: 74  AIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFN 133
             + R A C  ND+ D D D  V RT  RP+ SG  +  +AL    +  L++F L+L  N
Sbjct: 52  TFLMRSAGCCVNDVADRDFDRHVKRTAQRPVTSGAISVKEALALGAVLALMAFGLVLTTN 111

Query: 134 PFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIG 193
              +   FA L I+L+YPF+KRF+  PQ VLGI F+ G+ + + A+ A+    A +L  G
Sbjct: 112 RVTVLWSFAALAITLIYPFAKRFVSIPQAVLGIAFSFGIPMAFAAVQATVPVFAAWLLAG 171

Query: 194 TIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIF--VLCFMVAFCLL 251
            +FWV+ +DT YA  D+ DD  IG+ ++A  F       + + Y IF  V  +  A   L
Sbjct: 172 NLFWVLAYDTEYAMVDRDDDLKIGMKTSAITFGRFDVAAVMLSYAIFLAVWAWAGASRSL 231

Query: 252 TVNFFAWIGL 261
            V FFA I +
Sbjct: 232 GVLFFAGIAI 241


>gi|119468532|ref|ZP_01611623.1| 4-hydroxybenzoate octaprenyltransferase [Alteromonadales bacterium
           TW-7]
 gi|119448040|gb|EAW29305.1| 4-hydroxybenzoate octaprenyltransferase [Alteromonadales bacterium
           TW-7]
          Length = 292

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 88/283 (31%), Positives = 134/283 (47%), Gaps = 9/283 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L R     G  L + P  W+  LA          G  ++  ++ ++ +G +V R A 
Sbjct: 14  YLQLMRVDKPIGTLLLLWPTYWALWLANS--------GMPSLINFI-VFTLGVVVMRSAG 64

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  ID  V RT  RPL SG     +AL   +L   ++F+L+L  +   I +  
Sbjct: 65  CVINDFADRKIDGSVKRTAQRPLASGTVASGEALSLFLLLITLAFILVLMLSVNTIVLSV 124

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F   + + + A   +    A+ L +  + W V +
Sbjct: 125 GALALAFCYPFMKRYTQLPQVVLGAAFGWAIPMAYMASIDALPLQAWLLFVANVCWTVAY 184

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT+YA  D+ DD  IGV STA LF    +  +FIL  +F+        +  +N   W GL
Sbjct: 185 DTMYAMVDRDDDIKIGVKSTAILFGRFDRHIIFILNALFIALVAYIGFINQLNMAFWAGL 244

Query: 262 LIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           LIA  L + + + +       C   F +   VG+ I I L++S
Sbjct: 245 LIATALLVYQQVLILKRDRDACFKAFLNNHYVGMAIFIGLLLS 287


>gi|241959592|ref|XP_002422515.1| para-hydroxybenzoate: polyprenyltransferase, mitochondrial
           precursor, putative; phb:polyprenyltransferase, putative
           [Candida dubliniensis CD36]
 gi|223645860|emb|CAX40523.1| para-hydroxybenzoate: polyprenyltransferase, mitochondrial
           precursor, putative [Candida dubliniensis CD36]
          Length = 374

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 137/275 (49%), Gaps = 11/275 (4%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L +LPC W   +A+Y +     +   TI     ++ VGA+V R
Sbjct: 83  VIPYLELMRLEKPVGTWLLLLPCYWGITMASYSIAAPLWVTAKTIG----LFSVGALVMR 138

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D ++D+QV RT  RP+ SG+ +  QA+ +  +Q      +LL        
Sbjct: 139 GAGCTINDIWDRNLDNQVARTMERPITSGRVSVPQAVAWLGVQCFAGLAVLLSLPFECFY 198

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFS-WPAFFLCIGTIFW 197
           +G   L     YP  KRF   PQ +L I F+ G  +G+ A+ A  + W A  L I    W
Sbjct: 199 LGALSLPFVAAYPLFKRFTYYPQAMLSICFSWGCLLGFPAVGAPLNLWVAVPLFISNWIW 258

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFV-LCFMVAFC--LLTVN 254
            + +DT+YAHQDKK D   G+ STA  +  +TK    IL G+ V    + AF   + ++ 
Sbjct: 259 CLTYDTIYAHQDKKFDIKAGIKSTALAWGDKTKP---ILKGLTVSQAGLYAFSGFMNSMG 315

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHS 289
              ++    A+    K+II +D+   K C   F S
Sbjct: 316 PGFYVAGAYAIGRLYKQIIKVDLDDPKSCWGAFTS 350


>gi|71901871|ref|ZP_00683932.1| 4-hydroxybenzoate polyprenyl transferase, proteobacterial [Xylella
           fastidiosa Ann-1]
 gi|71728359|gb|EAO30529.1| 4-hydroxybenzoate polyprenyl transferase, proteobacterial [Xylella
           fastidiosa Ann-1]
          Length = 299

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 87/281 (30%), Positives = 132/281 (46%), Gaps = 9/281 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           + + PY  LAR     G+ L + P  W+  LAA      GV  W    W L ++  G  +
Sbjct: 18  NRLDPYWKLARGDHPVGFLLLLWPTWWALWLAA-----DGVPPW----WTLCVFTTGIWL 68

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
           TR A C  ND  D  +D  V RT +RPL +G  +   AL+      LI+F L+L  N   
Sbjct: 69  TRSAGCVINDYTDRWLDPHVERTCTRPLVTGTVSPRNALLMFGTLMLIAFGLVLTMNRLT 128

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           + +  A LF+++ YP+ KR+   PQ+ LG+ F  G+ + + A+       A+ L +  I 
Sbjct: 129 VLLSVAGLFLAMTYPYLKRYTHLPQIYLGLAFGWGIPMAFAAIQGKVPTLAWLLYVANIL 188

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
           W   +DT YA  D+ DD  +G  STA LF+    +   +LY + +L   +     T++  
Sbjct: 189 WTTAYDTWYAMVDRDDDIKMGAKSTAILFADLDLVVQGVLYTLMLLTLCLVGLRATLSHT 248

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
            WI L+ A+ L   + I         C   F     VG+ I
Sbjct: 249 YWISLISAVALIGYQFIIARRREPTACFRAFMHNNWVGMTI 289


>gi|330994718|ref|ZP_08318641.1| Para-hydroxybenzoate--polyprenyltransferase [Gluconacetobacter sp.
           SXCC-1]
 gi|329758359|gb|EGG74880.1| Para-hydroxybenzoate--polyprenyltransferase [Gluconacetobacter sp.
           SXCC-1]
          Length = 305

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 113/220 (51%), Gaps = 9/220 (4%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAY-PLRRAGVLGWSTIFWYLFIYIVGAIVT 77
           + PY  LAR     G  L  LP +W  +L  + P+R+          + + ++ +G++V 
Sbjct: 23  LRPYALLARLDRPIGTWLLFLPGIWGILLPDHVPVRQR--------LFLIVLFGIGSVVM 74

Query: 78  RGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVI 137
           RGA C  ND+ D DID QV RT  RPL SG  +  +A +F     L+ F +L+  NP   
Sbjct: 75  RGAGCVVNDMWDRDIDRQVARTAGRPLASGALSMREAALFLAALLLVGFNILMNLNPLSQ 134

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFW 197
            +G + L +  LYP +KR    PQ+V+G  F  G  +G+ A           L   TI W
Sbjct: 135 ILGASSLILVGLYPLAKRVTWWPQLVMGFTFGFGAPLGYAAAADRVDAALCALYAATIVW 194

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY 237
            + FDT+Y  QD +DD  IGV ST+RL +   +L++   Y
Sbjct: 195 QLGFDTIYGFQDMEDDARIGVRSTSRLMAGHARLFVGACY 234


>gi|118574213|sp|Q15ZT9|UBIA_PSEA6 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
          Length = 285

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 93/277 (33%), Positives = 141/277 (50%), Gaps = 17/277 (6%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           L R     G +L + P LW+ ++AA  L    + G         I++ G  V R A C  
Sbjct: 12  LMRADKPVGSYLLLWPTLWALMIAAQGLPPWHITG---------IFMAGVFVMRSAGCVI 62

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQAL-VFAVLQFLISFVLLLQFNPFVICVGFAL 143
           ND  D  +D +V RT++RPL SG  T  QAL +FA L   ++F+L+L  N   I +    
Sbjct: 63  NDYADRKVDGKVDRTKARPLVSGVVTEKQALGLFATL-VGVAFLLVLALNWQTIVLSLGA 121

Query: 144 LFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDT 203
           L ++ +YPF KR+   PQVVLG  F   + + + A+  +    A++L    + W V +DT
Sbjct: 122 LALASVYPFMKRYTHFPQVVLGAAFGWAIPMAFMAVTEAVPAIAWWLFAINVLWTVAYDT 181

Query: 204 VYAHQDKKDDELIGVNSTARLFSYQTKL--WLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
            YA  D+ DD  IGV STA LF    +L   L  L  + +L  M  +   T++F+  + L
Sbjct: 182 QYAMVDRNDDLQIGVKSTAVLFGQYDRLIIGLLQLSVVVMLLGMGQYLGFTLSFYVGVLL 241

Query: 262 LIALFLTIKRIIALDISCSKQCC-SFFHSAGVVGILI 297
              LF+  +R+I+     ++Q C S F +   VG+ I
Sbjct: 242 ASVLFIHQQRLIS---GRARQACFSAFLNNNYVGMAI 275


>gi|110807943|ref|YP_691463.1| 4-hydroxybenzoate octaprenyltransferase [Shigella flexneri 5 str.
           8401]
 gi|157163509|ref|YP_001460827.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli HS]
 gi|191167439|ref|ZP_03029253.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli B7A]
 gi|193062957|ref|ZP_03044049.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli E22]
 gi|193067864|ref|ZP_03048830.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli E110019]
 gi|194426826|ref|ZP_03059379.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli B171]
 gi|209921523|ref|YP_002295607.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli SE11]
 gi|218556597|ref|YP_002389511.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli IAI1]
 gi|218697748|ref|YP_002405415.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli 55989]
 gi|256019629|ref|ZP_05433494.1| 4-hydroxybenzoate octaprenyltransferase [Shigella sp. D9]
 gi|260846834|ref|YP_003224612.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli O103:H2
           str. 12009]
 gi|260858150|ref|YP_003232041.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli O26:H11
           str. 11368]
 gi|260870753|ref|YP_003237155.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli O111:H-
           str. 11128]
 gi|293476345|ref|ZP_06664753.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli B088]
 gi|300817959|ref|ZP_07098172.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           107-1]
 gi|300823580|ref|ZP_07103708.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           119-7]
 gi|300906350|ref|ZP_07124048.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS 84-1]
 gi|300924302|ref|ZP_07140281.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           182-1]
 gi|301302717|ref|ZP_07208846.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           124-1]
 gi|301330587|ref|ZP_07223195.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS 78-1]
 gi|307312117|ref|ZP_07591754.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli W]
 gi|309795847|ref|ZP_07690261.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           145-7]
 gi|331670902|ref|ZP_08371736.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli TA271]
 gi|331680169|ref|ZP_08380828.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli H591]
 gi|123047700|sp|Q0SXQ7|UBIA_SHIF8 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|166988445|sp|A8A7E0|UBIA_ECOHS RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790268|sp|B7LAY8|UBIA_ECO55 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790272|sp|B7M7V3|UBIA_ECO8A RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790275|sp|B6I5Q5|UBIA_ECOSE RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|110617491|gb|ABF06158.1| 4-hydroxybenzoate-octaprenyltransferase [Shigella flexneri 5 str.
           8401]
 gi|157069189|gb|ABV08444.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli HS]
 gi|190902481|gb|EDV62216.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli B7A]
 gi|192931216|gb|EDV83818.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli E22]
 gi|192958839|gb|EDV89276.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli E110019]
 gi|194415162|gb|EDX31431.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli B171]
 gi|209914782|dbj|BAG79856.1| 4-hydroxybenzoate-octaprenyltransferase [Escherichia coli SE11]
 gi|218354480|emb|CAV01323.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli 55989]
 gi|218363366|emb|CAR01019.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli IAI1]
 gi|257756799|dbj|BAI28301.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli O26:H11
           str. 11368]
 gi|257761981|dbj|BAI33478.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli O103:H2
           str. 12009]
 gi|257767109|dbj|BAI38604.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli O111:H-
           str. 11128]
 gi|291320798|gb|EFE60240.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli B088]
 gi|300401798|gb|EFJ85336.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS 84-1]
 gi|300419467|gb|EFK02778.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           182-1]
 gi|300523912|gb|EFK44981.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           119-7]
 gi|300529369|gb|EFK50431.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           107-1]
 gi|300841937|gb|EFK69697.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           124-1]
 gi|300843465|gb|EFK71225.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS 78-1]
 gi|306907924|gb|EFN38425.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli W]
 gi|308120508|gb|EFO57770.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           145-7]
 gi|315063366|gb|ADT77693.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli W]
 gi|315254711|gb|EFU34679.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS 85-1]
 gi|320200829|gb|EFW75415.1| 4-hydroxybenzoate polyprenyltransferase [Escherichia coli EC4100B]
 gi|323155622|gb|EFZ41797.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli EPECa14]
 gi|323161406|gb|EFZ47313.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli E128010]
 gi|323177609|gb|EFZ63194.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli 1180]
 gi|323182144|gb|EFZ67554.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli 1357]
 gi|323380571|gb|ADX52839.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli KO11]
 gi|324017117|gb|EGB86336.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           117-3]
 gi|324118612|gb|EGC12504.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli E1167]
 gi|331061816|gb|EGI33741.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli TA271]
 gi|331071632|gb|EGI42968.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli H591]
 gi|332103112|gb|EGJ06458.1| 4-hydroxybenzoate-octaprenyltransferase [Shigella sp. D9]
          Length = 290

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 86/247 (34%), Positives = 125/247 (50%), Gaps = 12/247 (4%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
            W L +++ G  + R A C  ND  D   D  V RT +RPLPSG  T  +A    V+  L
Sbjct: 46  LWILAVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVL 105

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           ISF+L+L  N   I +  A L ++ +YPF KR+   PQVVLG  F   + + + A+  S 
Sbjct: 106 ISFLLVLTLNTMTILLSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESV 165

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
               + + +  I W V +DT YA  D+ DD  IG+ STA LF    KL + IL  I VL 
Sbjct: 166 PLSCWLMFLANILWAVAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQ-IGVLA 224

Query: 244 FMVAFCLLTVNFFAW-----IGLLIALFLTIKRIIALDISCSKQCC-SFFHSAGVVGILI 297
            M     L  N   W     I +  ALF+  +++IA   +  ++ C   F +   VG+++
Sbjct: 225 LMAIIGEL--NGLGWGYYWSIVVAGALFVYQQKLIA---NREREACFKAFMNNNYVGLVL 279

Query: 298 LICLIIS 304
            + L +S
Sbjct: 280 FLGLAMS 286


>gi|331649900|ref|ZP_08350977.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli M605]
 gi|281181106|dbj|BAI57436.1| 4-hydroxybenzoate-octaprenyltransferase [Escherichia coli SE15]
 gi|330908361|gb|EGH36880.1| 4-hydroxybenzoate polyprenyltransferase [Escherichia coli AA86]
 gi|331041280|gb|EGI13433.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli M605]
          Length = 290

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 86/247 (34%), Positives = 125/247 (50%), Gaps = 12/247 (4%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
            W L +++ G  + R A C  ND  D   D  V RT +RPLPSG  T  +A    V+  L
Sbjct: 46  LWILAVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARTLFVVLVL 105

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           ISF+L+L  N   I +  A L ++ +YPF KR+   PQVVLG  F   + + + A+  S 
Sbjct: 106 ISFLLVLTLNTMTILLSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESV 165

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
               + + +  I W V +DT YA  D+ DD  IG+ STA LF    KL + IL  I VL 
Sbjct: 166 PLSCWLMFLANILWAVAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQ-IGVLA 224

Query: 244 FMVAFCLLTVNFFAW-----IGLLIALFLTIKRIIALDISCSKQCC-SFFHSAGVVGILI 297
            M     L  N   W     I +  ALF+  +++IA   +  ++ C   F +   VG+++
Sbjct: 225 LMAIIGEL--NGLGWGYYWSILVAGALFVYQQKLIA---NREREACFKAFMNNNYVGLVL 279

Query: 298 LICLIIS 304
            + L +S
Sbjct: 280 FLGLAMS 286


>gi|194477199|ref|YP_002049378.1| probable 4-hydroxybenzoate- octaprenyltransferase [Paulinella
           chromatophora]
 gi|171192206|gb|ACB43168.1| probable 4-hydroxybenzoate- octaprenyltransferase [Paulinella
           chromatophora]
          Length = 319

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 93/291 (31%), Positives = 140/291 (48%), Gaps = 17/291 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L RW+  TG  + + P  WS  L   P+         T+F+ +FI   G I   GA 
Sbjct: 35  WLNLLRWNKPTGRLILLFPAAWSLWLV--PVSPPP----PTMFFLIFI---GGIAVSGAG 85

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLL----QFNPFVI 137
           C  NDL D  ID  V RTR RPL S Q + + A+V  +L  LI+F +++    +  P  +
Sbjct: 86  CIINDLWDRRIDPLVERTRHRPLASNQISVYSAIVLLLLCLLIAFGVVMTLPNEVRPLCL 145

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW-PAFFLC-IGTI 195
                 L   LLYP +KR+   PQ++L   +   V + W     +  + P+ F C +GTI
Sbjct: 146 SASLVALASILLYPSAKRWFALPQIILAFCWGFAVLIPWIISTGNLVYSPSLFFCWLGTI 205

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
            W   FDTVYA  D++DD L+G+ S+A          + I YGI  LC  ++     +N 
Sbjct: 206 VWTFGFDTVYAMADRRDDILLGIRSSALSLGKHVPFVVVICYGIAGLCIAISAQSRQING 265

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQC--CSFFHSAGVVGILILICLIIS 304
             W+   +A  + IK  ++L    S +      F    ++G LI I L+I 
Sbjct: 266 GFWLIWGLAFGIMIKESLSLHNQGSPRSFYGQHFKRQAILGGLIFIALLIG 316


>gi|71026514|ref|XP_762926.1| 4-hydroxybenzoate octaprenyltransferase [Theileria parva strain
           Muguga]
 gi|68349878|gb|EAN30643.1| 4-hydroxybenzoate octaprenyltransferase, putative [Theileria parva]
          Length = 393

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 80/276 (28%), Positives = 130/276 (47%), Gaps = 21/276 (7%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYP------LRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           L R H+     +  LP +WS  LA  P      L++  +L             +GA   R
Sbjct: 100 LMRVHTLMPVVIFALPAMWSAALALPPVVTFLELKKIALL------------CLGAFSAR 147

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
            A C  NDL D + D  V RT+ RPL SG     +AL+  +    I+  +L QF+P  I 
Sbjct: 148 SAGCCVNDLADRNFDKLVQRTKIRPLASGSINTTEALITLMFNSTIALTILYQFDPTTIG 207

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHAS-FSWPAFFLCIGTIFW 197
           +G        +YPF KR+I  PQ++LG+  + G  + W A+  +  +     + + +  W
Sbjct: 208 LGLLTGVTCSIYPFMKRYIKYPQLILGLSSSIGTLMAWTAISGNPLTMAPLCIYLTSSLW 267

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFIL-YGIFVLCFMVAFCLLTVNFF 256
            + +DTVYAHQDK DD  +G+ S A  +  +TK    I+ Y + +L     +     + F
Sbjct: 268 SLIYDTVYAHQDKNDDIKLGLGSLAIEWGDKTKKMCNIVAYNMSILMATCGYLAHLTDLF 327

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGV 292
            ++ ++I+    ++ I  +D+S    C  FF    +
Sbjct: 328 -YVSVVISHLWMLREIKKVDLSDPANCLLFFKKTTI 362


>gi|83769349|dbj|BAE59486.1| unnamed protein product [Aspergillus oryzae]
          Length = 402

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 109/222 (49%), Gaps = 22/222 (9%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAA-----YPLRRAGVLGWSTIFWYLFIYIVGAI 75
           PY  L R    TG +    PC +ST+LAA      P +  G +G         +++ GA+
Sbjct: 84  PYAELIRLDKPTGTYYLFFPCAFSTLLAAPMTSSTPFQVLGTMG---------LFLAGAL 134

Query: 76  VTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPF 135
           V RGA CT NDL D ++D  V RT+ RP+     +  +A+VF  +Q L    +LLQF   
Sbjct: 135 VMRGAGCTINDLWDRNLDPHVERTKFRPIARRAVSPRKAVVFTGMQLLAGLGILLQFPTL 194

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL-------HASFSWPAF 188
            +  G   L +   YP +KR    PQ VLG+ F+ G  +G+ AL       H++    A 
Sbjct: 195 CLWYGIPSLLLVTTYPLAKRITYYPQAVLGLTFSWGAMMGFPALGIDLLSNHSALE-SAA 253

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
            L    + W + +D +YAH D KDD   G+ S A    + TK
Sbjct: 254 ALYSSCVAWTILYDMIYAHMDIKDDVAAGIKSIALRHEHNTK 295


>gi|226946854|ref|YP_002801927.1| 4-hydroxybenzoate octaprenyltransferase [Azotobacter vinelandii DJ]
 gi|259550842|sp|C1DK47|UBIA_AZOVD RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|226721781|gb|ACO80952.1| 4-hydroxybenzoate polyprenyl transferase protein [Azotobacter
           vinelandii DJ]
          Length = 295

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 94/292 (32%), Positives = 143/292 (48%), Gaps = 27/292 (9%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           ++ L R     G +L + P LW+  +AA           S    ++ I+  G I+ R A 
Sbjct: 19  FIQLVRLDRPIGIYLLLWPTLWAVWIAA---------DGSPSLKHVLIFTCGVILMRSAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQC-TRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
           C  ND  D + D  V RTR RPL +G+  TR    +FAVL  L SF L+L  +PF + + 
Sbjct: 70  CVINDFADRNFDGHVARTRQRPLATGRIRTREAWALFAVLVAL-SFGLVLLTDPFTVALS 128

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
           F  L ++ LYPF KR+   PQ+VLG  ++ G+ + + A        A+ +    + W V 
Sbjct: 129 FGALAVASLYPFMKRYTHLPQLVLGAAYSWGIPMAFTAATGRLPLEAWLIFAANLAWTVA 188

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT YA  D++DD  IGV STA LF    +  +  L G+ +   +V    L +  +  +G
Sbjct: 189 YDTYYAMTDREDDLKIGVKSTAILFGAADRAIILALQGLTLGLLLVVGMRLGLGPYFHLG 248

Query: 261 LLIAL------FLTIKRIIALDISCSKQCC--SFFHSAGVVGILILICLIIS 304
           LL+A       F+T +R          Q C  +F H+    G+ IL+ LI+ 
Sbjct: 249 LLVAALCFAWEFVTTRR-------REPQACFRAFLHNHW-AGLAILVGLILD 292


>gi|15834277|ref|NP_313050.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli O157:H7
           str. Sakai]
 gi|16131866|ref|NP_418464.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli str. K-12
           substr. MG1655]
 gi|26250822|ref|NP_756862.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli CFT073]
 gi|74314534|ref|YP_312953.1| 4-hydroxybenzoate octaprenyltransferase [Shigella sonnei Ss046]
 gi|82546391|ref|YP_410338.1| 4-hydroxybenzoate octaprenyltransferase [Shigella boydii Sb227]
 gi|82779550|ref|YP_405899.1| 4-hydroxybenzoate octaprenyltransferase [Shigella dysenteriae
           Sd197]
 gi|89110761|ref|AP_004541.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli str. K-12
           substr. W3110]
 gi|110644378|ref|YP_672108.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli 536]
 gi|157157014|ref|YP_001465541.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli E24377A]
 gi|168750828|ref|ZP_02775850.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4113]
 gi|168755192|ref|ZP_02780199.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4401]
 gi|168760887|ref|ZP_02785894.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4501]
 gi|168766282|ref|ZP_02791289.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4486]
 gi|168774379|ref|ZP_02799386.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4196]
 gi|168780434|ref|ZP_02805441.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4076]
 gi|168784637|ref|ZP_02809644.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC869]
 gi|168798316|ref|ZP_02823323.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC508]
 gi|170021962|ref|YP_001726916.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli ATCC
           8739]
 gi|170083497|ref|YP_001732817.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli str. K-12
           substr. DH10B]
 gi|170681494|ref|YP_001746430.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli SMS-3-5]
 gi|187733486|ref|YP_001882737.1| 4-hydroxybenzoate octaprenyltransferase [Shigella boydii CDC
           3083-94]
 gi|188494348|ref|ZP_03001618.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli 53638]
 gi|191171929|ref|ZP_03033474.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli F11]
 gi|194437311|ref|ZP_03069409.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli 101-1]
 gi|195935807|ref|ZP_03081189.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli O157:H7
           str. EC4024]
 gi|208809634|ref|ZP_03251971.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4206]
 gi|208814390|ref|ZP_03255719.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4045]
 gi|208819595|ref|ZP_03259915.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4042]
 gi|209399362|ref|YP_002273561.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4115]
 gi|215489378|ref|YP_002331809.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli O127:H6
           str. E2348/69]
 gi|217326339|ref|ZP_03442423.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. TW14588]
 gi|218692325|ref|YP_002400537.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli ED1a]
 gi|218702705|ref|YP_002410334.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli IAI39]
 gi|218707662|ref|YP_002415181.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli UMN026]
 gi|227886954|ref|ZP_04004759.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli 83972]
 gi|238903149|ref|YP_002928945.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli BW2952]
 gi|253775332|ref|YP_003038163.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254037036|ref|ZP_04871113.1| 4-hydroxybenzoate-octaprenyl transferase [Escherichia sp. 1_1_43]
 gi|254163976|ref|YP_003047084.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli B str.
           REL606]
 gi|254796042|ref|YP_003080879.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli O157:H7
           str. TW14359]
 gi|256024913|ref|ZP_05438778.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia sp. 4_1_40B]
 gi|261223443|ref|ZP_05937724.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261256978|ref|ZP_05949511.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli O157:H7
           str. FRIK966]
 gi|291285457|ref|YP_003502275.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli O55:H7
           str. CB9615]
 gi|293402679|ref|ZP_06646776.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli FVEC1412]
 gi|293407773|ref|ZP_06651613.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli B354]
 gi|293417545|ref|ZP_06660167.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli B185]
 gi|297519509|ref|ZP_06937895.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli OP50]
 gi|298378208|ref|ZP_06988092.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli FVEC1302]
 gi|300899844|ref|ZP_07118058.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           198-1]
 gi|300917313|ref|ZP_07133986.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           115-1]
 gi|300929778|ref|ZP_07145230.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           187-1]
 gi|300938175|ref|ZP_07152945.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS 21-1]
 gi|300946611|ref|ZP_07160870.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           116-1]
 gi|300957551|ref|ZP_07169758.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           175-1]
 gi|300980489|ref|ZP_07175036.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           200-1]
 gi|300992953|ref|ZP_07180108.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS 45-1]
 gi|301019153|ref|ZP_07183354.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           196-1]
 gi|301021558|ref|ZP_07185561.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS 69-1]
 gi|301046986|ref|ZP_07194096.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           185-1]
 gi|301645027|ref|ZP_07244990.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           146-1]
 gi|306815847|ref|ZP_07449992.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli NC101]
 gi|307140730|ref|ZP_07500086.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli H736]
 gi|309787526|ref|ZP_07682138.1| 4-hydroxybenzoate polyprenyl transferase [Shigella dysenteriae
           1617]
 gi|312965300|ref|ZP_07779533.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli 2362-75]
 gi|331644780|ref|ZP_08345897.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli H736]
 gi|331655860|ref|ZP_08356848.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli M718]
 gi|331660608|ref|ZP_08361540.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli TA206]
 gi|331665710|ref|ZP_08366604.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli TA143]
 gi|331675525|ref|ZP_08376273.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli TA280]
 gi|331685787|ref|ZP_08386368.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli H299]
 gi|84029378|sp|P0AGK3|UBIA_ECO57 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|84029379|sp|P0AGK2|UBIA_ECOL6 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|84029380|sp|P0AGK1|UBIA_ECOLI RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|118574200|sp|Q0TA22|UBIA_ECOL5 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|118574227|sp|Q31TU8|UBIA_SHIBS RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|118574228|sp|Q327U7|UBIA_SHIDS RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|118574229|sp|Q3YUU4|UBIA_SHISS RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|166988444|sp|A7ZUR2|UBIA_ECO24 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|189036987|sp|B1IUL2|UBIA_ECOLC RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790266|sp|B7UPK1|UBIA_ECO27 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790269|sp|B5Z181|UBIA_ECO5E RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790270|sp|B7NS04|UBIA_ECO7I RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790271|sp|B7MRH2|UBIA_ECO81 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790273|sp|B1XC39|UBIA_ECODH RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790274|sp|B7NFY4|UBIA_ECOLU RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790276|sp|B1LPK5|UBIA_ECOSM RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790301|sp|B2TX76|UBIA_SHIB3 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|259550845|sp|C5A133|UBIA_ECOBW RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|26111253|gb|AAN83436.1|AE016770_236 4-hydroxybenzoate octaprenyltransferase [Escherichia coli CFT073]
 gi|41181|emb|CAA49270.1| cyr [Escherichia coli K-12]
 gi|43232|emb|CAA47182.1| 4-hydroxybenzoate-octaprenyl transferase [Escherichia coli]
 gi|43235|emb|CAA40682.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli]
 gi|148101|gb|AAA24712.1| 4-hydroxybenzoate-octaprenyl transferase [Escherichia coli str.
           K-12 substr. W3110]
 gi|148108|gb|AAA24717.1| 4-hydroxybenzoate-octaprenyl transferase [Escherichia coli str.
           K-12 substr. W3110]
 gi|1790473|gb|AAC77010.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli str. K-12
           substr. MG1655]
 gi|13364500|dbj|BAB38446.1| 4-hydroxybenzoate-octaprenyltransferase [Escherichia coli O157:H7
           str. Sakai]
 gi|68270932|gb|AAY88960.1| 4-hydroxybenzoate-octaprenyl transferase [Escherichia coli
           BL21(DE3)]
 gi|73858011|gb|AAZ90718.1| 4-hydroxybenzoate-octaprenyltransferase [Shigella sonnei Ss046]
 gi|81243698|gb|ABB64408.1| 4-hydroxybenzoate-octaprenyltransferase [Shigella dysenteriae
           Sd197]
 gi|81247802|gb|ABB68510.1| 4-hydroxybenzoate-octaprenyltransferase [Shigella boydii Sb227]
 gi|85676792|dbj|BAE78042.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli str. K12
           substr. W3110]
 gi|110345970|gb|ABG72207.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli 536]
 gi|157079044|gb|ABV18752.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli E24377A]
 gi|169756890|gb|ACA79589.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli ATCC
           8739]
 gi|169891332|gb|ACB05039.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli str. K-12
           substr. DH10B]
 gi|170519212|gb|ACB17390.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli SMS-3-5]
 gi|187430478|gb|ACD09752.1| 4-hydroxybenzoate polyprenyl transferase [Shigella boydii CDC
           3083-94]
 gi|187769967|gb|EDU33811.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4196]
 gi|188015032|gb|EDU53154.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4113]
 gi|188489547|gb|EDU64650.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli 53638]
 gi|189001664|gb|EDU70650.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4076]
 gi|189357563|gb|EDU75982.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4401]
 gi|189364221|gb|EDU82640.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4486]
 gi|189368530|gb|EDU86946.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4501]
 gi|189374762|gb|EDU93178.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC869]
 gi|189379202|gb|EDU97618.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC508]
 gi|190907694|gb|EDV67288.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli F11]
 gi|194423867|gb|EDX39856.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli 101-1]
 gi|208729435|gb|EDZ79036.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4206]
 gi|208735667|gb|EDZ84354.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4045]
 gi|208739718|gb|EDZ87400.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4042]
 gi|209160762|gb|ACI38195.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. EC4115]
 gi|209751348|gb|ACI73981.1| 4-hydroxybenzoate-octaprenyltransferase [Escherichia coli]
 gi|209751350|gb|ACI73982.1| 4-hydroxybenzoate-octaprenyltransferase [Escherichia coli]
 gi|209751352|gb|ACI73983.1| 4-hydroxybenzoate-octaprenyltransferase [Escherichia coli]
 gi|209751354|gb|ACI73984.1| 4-hydroxybenzoate-octaprenyltransferase [Escherichia coli]
 gi|209751356|gb|ACI73985.1| 4-hydroxybenzoate-octaprenyltransferase [Escherichia coli]
 gi|215267450|emb|CAS11903.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli O127:H6
           str. E2348/69]
 gi|217322560|gb|EEC30984.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli O157:H7
           str. TW14588]
 gi|218372691|emb|CAR20567.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli IAI39]
 gi|218429889|emb|CAR10860.2| p-hydroxybenzoate octaprenyltransferase [Escherichia coli ED1a]
 gi|218434759|emb|CAR15691.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli UMN026]
 gi|222035754|emb|CAP78499.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli LF82]
 gi|226840142|gb|EEH72144.1| 4-hydroxybenzoate-octaprenyl transferase [Escherichia sp. 1_1_43]
 gi|227836095|gb|EEJ46561.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli 83972]
 gi|238862067|gb|ACR64065.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli BW2952]
 gi|242379570|emb|CAQ34389.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli
           BL21(DE3)]
 gi|253326376|gb|ACT30978.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975877|gb|ACT41548.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli B str.
           REL606]
 gi|253980033|gb|ACT45703.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli
           BL21(DE3)]
 gi|254595442|gb|ACT74803.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli O157:H7
           str. TW14359]
 gi|260451131|gb|ACX41553.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli DH1]
 gi|284924134|emb|CBG37233.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli 042]
 gi|290765330|gb|ADD59291.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli O55:H7
           str. CB9615]
 gi|291429594|gb|EFF02608.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli FVEC1412]
 gi|291430263|gb|EFF03261.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli B185]
 gi|291472024|gb|EFF14506.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli B354]
 gi|298280542|gb|EFI22043.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli FVEC1302]
 gi|299882377|gb|EFI90588.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           196-1]
 gi|300301074|gb|EFJ57459.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           185-1]
 gi|300307791|gb|EFJ62311.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           200-1]
 gi|300315725|gb|EFJ65509.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           175-1]
 gi|300356615|gb|EFJ72485.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           198-1]
 gi|300397992|gb|EFJ81530.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS 69-1]
 gi|300406727|gb|EFJ90265.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS 45-1]
 gi|300415457|gb|EFJ98767.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           115-1]
 gi|300453710|gb|EFK17330.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           116-1]
 gi|300456833|gb|EFK20326.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS 21-1]
 gi|300462284|gb|EFK25777.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           187-1]
 gi|301076649|gb|EFK91455.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           146-1]
 gi|305850822|gb|EFM51278.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli NC101]
 gi|307556185|gb|ADN48960.1| 4-hydroxybenzoate-octaprenyltransferase [Escherichia coli ABU
           83972]
 gi|308925104|gb|EFP70599.1| 4-hydroxybenzoate polyprenyl transferase [Shigella dysenteriae
           1617]
 gi|309704452|emb|CBJ03801.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli ETEC
           H10407]
 gi|312289974|gb|EFR17861.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli 2362-75]
 gi|312948619|gb|ADR29446.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli O83:H1
           str. NRG 857C]
 gi|315138594|dbj|BAJ45753.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli DH1]
 gi|315291527|gb|EFU50887.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           153-1]
 gi|315297513|gb|EFU56792.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS 16-3]
 gi|315617408|gb|EFU98014.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli 3431]
 gi|320174468|gb|EFW49608.1| 4-hydroxybenzoate polyprenyltransferase [Shigella dysenteriae CDC
           74-1112]
 gi|320187471|gb|EFW62159.1| 4-hydroxybenzoate polyprenyltransferase [Shigella flexneri CDC
           796-83]
 gi|320190857|gb|EFW65507.1| 4-hydroxybenzoate polyprenyltransferase [Escherichia coli O157:H7
           str. EC1212]
 gi|320193401|gb|EFW68038.1| 4-hydroxybenzoate polyprenyltransferase [Escherichia coli
           WV_060327]
 gi|320638797|gb|EFX08443.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli O157:H7
           str. G5101]
 gi|320644165|gb|EFX13230.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli O157:H-
           str. 493-89]
 gi|320649484|gb|EFX18008.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli O157:H-
           str. H 2687]
 gi|320654881|gb|EFX22842.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320660728|gb|EFX28185.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320665657|gb|EFX32694.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli O157:H7
           str. LSU-61]
 gi|323164566|gb|EFZ50367.1| 4-hydroxybenzoate polyprenyl transferase [Shigella sonnei 53G]
 gi|323190095|gb|EFZ75373.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli RN587/1]
 gi|323935529|gb|EGB31860.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli E1520]
 gi|323946173|gb|EGB42207.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli H120]
 gi|323960447|gb|EGB56080.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli H489]
 gi|323969826|gb|EGB65107.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli TA007]
 gi|323975329|gb|EGB70432.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli TW10509]
 gi|324007797|gb|EGB77016.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS 57-2]
 gi|324014297|gb|EGB83516.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS 60-1]
 gi|326340547|gb|EGD64345.1| 4-hydroxybenzoate polyprenyltransferase [Escherichia coli O157:H7
           str. 1125]
 gi|326346512|gb|EGD70246.1| 4-hydroxybenzoate polyprenyltransferase [Escherichia coli O157:H7
           str. 1044]
 gi|331035755|gb|EGI07993.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli H736]
 gi|331046214|gb|EGI18304.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli M718]
 gi|331051650|gb|EGI23689.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli TA206]
 gi|331056761|gb|EGI28755.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli TA143]
 gi|331067299|gb|EGI38706.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli TA280]
 gi|331076984|gb|EGI48201.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli H299]
 gi|332083532|gb|EGI88752.1| 4-hydroxybenzoate polyprenyl transferase [Shigella boydii 5216-82]
 gi|332087810|gb|EGI92936.1| 4-hydroxybenzoate polyprenyl transferase [Shigella boydii 3594-74]
 gi|450009|prf||1920311B hydroxybenzoate-octaprenyl transferase
          Length = 290

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 86/247 (34%), Positives = 125/247 (50%), Gaps = 12/247 (4%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
            W L +++ G  + R A C  ND  D   D  V RT +RPLPSG  T  +A    V+  L
Sbjct: 46  LWILAVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVL 105

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           ISF+L+L  N   I +  A L ++ +YPF KR+   PQVVLG  F   + + + A+  S 
Sbjct: 106 ISFLLVLTLNTMTILLSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESV 165

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
               + + +  I W V +DT YA  D+ DD  IG+ STA LF    KL + IL  I VL 
Sbjct: 166 PLSCWLMFLANILWAVAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQ-IGVLA 224

Query: 244 FMVAFCLLTVNFFAW-----IGLLIALFLTIKRIIALDISCSKQCC-SFFHSAGVVGILI 297
            M     L  N   W     I +  ALF+  +++IA   +  ++ C   F +   VG+++
Sbjct: 225 LMAIIGEL--NGLGWGYYWSILVAGALFVYQQKLIA---NREREACFKAFMNNNYVGLVL 279

Query: 298 LICLIIS 304
            + L +S
Sbjct: 280 FLGLAMS 286


>gi|119947071|ref|YP_944751.1| 4-hydroxybenzoate polyprenyl transferase [Psychromonas ingrahamii
           37]
 gi|167011557|sp|A1T087|UBIA_PSYIN RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|119865675|gb|ABM05152.1| 4-hydroxybenzoate octaprenyltransferase [Psychromonas ingrahamii
           37]
          Length = 287

 Score =  119 bits (297), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 138/276 (50%), Gaps = 9/276 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           YV L R +   G  L + P LW+  +AA      GVL          ++  G  + R A 
Sbjct: 12  YVELMRINKPIGTLLLLWPTLWALWIAAQGFPDLGVL---------IVFSAGVFLMRSAG 62

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D +ID  V RT+ RPLPSG+ T  +A++   +  ++SF+L+L  N   I + F
Sbjct: 63  CVINDFADRNIDGFVERTKHRPLPSGRATSTEAIILFFILAIVSFLLVLTQNSLTIQLSF 122

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++  YPF KRF   PQ+VLG+ F+  + + + A   +     + +    I W + +
Sbjct: 123 AGLLLAFAYPFMKRFTQLPQLVLGLAFSWSIPMAFAAQANALPAVVWIIFAVNIIWTIAY 182

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT+YA  D++DD  IGV STA LF+   K+ + +L    ++   +   L  +N+  +I L
Sbjct: 183 DTLYAMVDREDDLKIGVKSTAILFASNDKIIIALLQLTSLILLSLLGWLEDLNWIYFIAL 242

Query: 262 LIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
           L+   L +++ + +       C   F     VG +I
Sbjct: 243 LVVGGLFLRQQLQIKNREKTACFKAFLDNNYVGFVI 278


>gi|22297945|ref|NP_681192.1| prenyltransferase [Thermosynechococcus elongatus BP-1]
 gi|22294123|dbj|BAC07954.1| 4-hydroxybenzoate-octaprenyl transferase [Thermosynechococcus
           elongatus BP-1]
          Length = 301

 Score =  119 bits (297), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 118/247 (47%), Gaps = 9/247 (3%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           L RWH   G  + ++P LWS  LA+  L    +L          I  +GAI T  A C  
Sbjct: 19  LLRWHKPAGRLILLIPALWSLTLASEGLPSLKLL---------LIITMGAIATSAAGCIV 69

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND  D +ID  V RT++RPL S + +   AL   V+  L ++ L     P    +  A +
Sbjct: 70  NDCWDRNIDPHVQRTQNRPLASRRLSLGVALGLMVIALLCAWGLTFYLTPLGYWLAVAAV 129

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            + LLYP +KR +  PQ+VL + +   V + W A+    +     L    + W + FDTV
Sbjct: 130 PVILLYPLAKRVLPIPQLVLAVAWGFAVLIPWAAVQGRLTLTTAGLWAAVVMWTLAFDTV 189

Query: 205 YAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIA 264
           YA  D+ DD  +GVNS+A  F     L + + Y + V+  M+      + +  W+ L + 
Sbjct: 190 YAMPDRPDDRRLGVNSSALFFGAYAPLAIALFYALTVVFLMMVGVRAGLTWRFWLALAVT 249

Query: 265 LFLTIKR 271
            +  +++
Sbjct: 250 TYFWLRQ 256


>gi|320580291|gb|EFW94514.1| Para hydroxybenzoate: polyprenyl transferase [Pichia angusta DL-1]
          Length = 348

 Score =  119 bits (297), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 91/292 (31%), Positives = 144/292 (49%), Gaps = 20/292 (6%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAY----PLRRAGVLGWSTIFWYLFIYIVGAIV 76
           PY+ L R     G  L + PCLW+  +AAY    PL        ++  + + ++ VGA V
Sbjct: 60  PYMELMRIEKPIGTKLLLSPCLWAITMAAYMSSAPL--------ASTVYMMSVFGVGAFV 111

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT NDL+D ++D++V RT  RP+ SG+ +  QA VF   Q  +  ++LLQ     
Sbjct: 112 MRGAGCTINDLLDRNLDNKVARTMERPITSGRVSVKQASVFLAAQLGVGLLVLLQLPMDC 171

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTI 195
             +G + L +   YP  KRF   PQV L + F  G  +G+ A+   ++ P    L +   
Sbjct: 172 FLLGASSLALVGTYPLFKRFTYYPQVALSLCFNWGALLGFPAM-GVWNLPVMIPLYLSGF 230

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
           FW +++DT+YAHQDKK D   G+ STA  +  ++K     L    + C+ ++  L  +  
Sbjct: 231 FWCMHYDTIYAHQDKKFDAEAGIKSTALAWGDKSKTIFHGLTAAQMGCYTLSGFLAGMGP 290

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGV------VGILILICL 301
             + G     +  ++    +D+   K C  +F           +GIL+  CL
Sbjct: 291 GFYFGAAYGAYRLLRMTQLVDLDDPKSCGFWFRENIKTGHTFWLGILVDYCL 342


>gi|50119576|ref|YP_048743.1| 4-hydroxybenzoate octaprenyltransferase [Pectobacterium
           atrosepticum SCRI1043]
 gi|81646240|sp|Q6D9I8|UBIA_ERWCT RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|49610102|emb|CAG73542.1| 4-hydroxybenzoate octaprenyl transferase [Pectobacterium
           atrosepticum SCRI1043]
          Length = 287

 Score =  119 bits (297), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 87/284 (30%), Positives = 128/284 (45%), Gaps = 9/284 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  LA          G +   W LF+++ G  + R A 
Sbjct: 13  YCRLMRIDKPIGSLLLLWPTLWALWLAG---------GGAPAPWTLFVFVAGVFLMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D   D  V RT SRPLPSG+ +   A +  V+  L++F L+L  N   I +  
Sbjct: 64  CVINDYADRHFDGHVKRTASRPLPSGEVSEQSAKILFVVLVLLAFGLVLTLNKMTIWLSV 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++ +YPF KR    PQ VLG  F   + + + A+  S     + + +  I W V +
Sbjct: 124 AGLVLAWVYPFMKRVSHLPQFVLGAAFGWSIPMAYAAVSESLPATCWMMFLAYICWTVAY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF     + + +L    +   +    +  +     I L
Sbjct: 184 DTQYAMVDRDDDLKIGVKSTAILFGRFDNIIIGLLQFSMLALLLALGNITGLGIPYTISL 243

Query: 262 LIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
           L+A  + I + I         C   FH+    G+ I I ++  L
Sbjct: 244 LVAAGMFIYQQILTAGRERDACFKAFHNNKYAGMAIFIGVLFGL 287


>gi|304398435|ref|ZP_07380308.1| 4-hydroxybenzoate polyprenyl transferase [Pantoea sp. aB]
 gi|304353940|gb|EFM18314.1| 4-hydroxybenzoate polyprenyl transferase [Pantoea sp. aB]
          Length = 295

 Score =  119 bits (297), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 139/286 (48%), Gaps = 15/286 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  LA   +    VL          +++ G  V R A 
Sbjct: 14  YARLMRIDKPIGTLLLMWPTLWALWLADMSIPPLPVLA---------VFVAGVFVMRAAG 64

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT+ RPL SG  +  +A +  V+  L++F L+L  N   I +  
Sbjct: 65  CVINDYADRKVDGHVERTKHRPLASGAVSAKEAKLLFVILALVAFALVLTMNLMTIMLSV 124

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++ +YPF KR+   PQVVLG  F   + + W A+  S     + + I  I W V +
Sbjct: 125 VGLALAWVYPFMKRYTHLPQVVLGAAFGWAIPMAWSAVSESLPLVCWLVFIANICWTVAY 184

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN-FFAWIG 260
           DT YA  D+ DD  IGV STA LF    KL + +L    +L   +   +L +N  F W  
Sbjct: 185 DTQYAMVDRDDDLKIGVKSTAILFGRFDKLIIGLLQLATLLLMALVGMMLHLNGAFYWTL 244

Query: 261 LL-IALFLTIKRIIALDISCSKQCC-SFFHSAGVVGILILICLIIS 304
           LL  ALF+  +++IA      +Q C   F +   VG+++ + ++++
Sbjct: 245 LLAAALFVYQQKLIA---GRERQPCFQAFLNNNYVGMVLFLGVLMN 287


>gi|322709878|gb|EFZ01453.1| para-hydroxybenzoate-polyprenyltransferase Coq2, putative
           [Metarhizium anisopliae ARSEF 23]
          Length = 408

 Score =  119 bits (297), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 108/220 (49%), Gaps = 16/220 (7%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAA---YPLRRAG-VLGWSTIFWYLFIYIVGAIV 76
           PY  L R    TG +    PCL+ST++AA    P+   G V+G S +F+       GA++
Sbjct: 97  PYAELIRIDKPTGTYYLYFPCLFSTLMAAPMVSPMPSVGSVVGTSLLFF------SGALI 150

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            RGA CT NDL D ++D  V RTR RP+     + F  LVF   Q L    +L+QF    
Sbjct: 151 MRGAGCTINDLWDRNLDPHVSRTRLRPIARRAISPFNGLVFTGAQLLAGLGILIQFPAPC 210

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL------HASFSWPAFFL 190
           +  G   L     YP +KR    PQ VLG+ F+ G  +G+ AL      + S    A  L
Sbjct: 211 LFYGIPSLLFVASYPLAKRVTYYPQFVLGLTFSWGAIMGFPALGIDLLSNGSALTAAACL 270

Query: 191 CIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
               I W V +D +YAH D KDD   G+ S A     QTK
Sbjct: 271 YGSNIAWTVLYDMIYAHMDIKDDAKAGIKSIALKHDSQTK 310


>gi|209525408|ref|ZP_03273948.1| 4-hydroxybenzoate polyprenyl transferase [Arthrospira maxima
           CS-328]
 gi|209494088|gb|EDZ94403.1| 4-hydroxybenzoate polyprenyl transferase [Arthrospira maxima
           CS-328]
          Length = 294

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 101/204 (49%), Gaps = 9/204 (4%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           V L RW    G  + ++P LW+  LA          G +     + + + G++ T  A C
Sbjct: 16  VRLLRWDKPAGRLILMIPALWAIFLAT---------GGTPPLTLILVIVFGSLATSAAGC 66

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFA 142
             NDL D +ID +V RTR+RPL S   T    +V  ++ F  +F L L  NP    +  A
Sbjct: 67  VVNDLWDRNIDPEVERTRNRPLASRALTIKTGVVVGLVAFACAFGLALYLNPLSFWLSVA 126

Query: 143 LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFD 202
            + + + YP +KR    PQ+VL I +   V + W A + S       L   T+ W + FD
Sbjct: 127 AVPVIICYPLAKRVFPVPQLVLSIAWGFAVLISWSAANGSLEASTGLLWGATVLWTLGFD 186

Query: 203 TVYAHQDKKDDELIGVNSTARLFS 226
           TVYA  D++DD  +G+NS+A  F 
Sbjct: 187 TVYAMSDREDDRRLGINSSALFFG 210


>gi|17231045|ref|NP_487593.1| 4-hydroxybenzoate polyprenyltransferase [Nostoc sp. PCC 7120]
 gi|17132686|dbj|BAB75252.1| 4-hydroxybenzoate-octaprenyl transferase [Nostoc sp. PCC 7120]
          Length = 290

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 117/243 (48%), Gaps = 15/243 (6%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAY---PLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           L RWH   G  + ++P LW+  LAA    PL   GV+            ++G + T  A 
Sbjct: 16  LLRWHKPEGRLILMIPALWAVFLAAAGKPPLPLVGVI------------VLGTLATSAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  NDL D DID +V RTR RPL +   +    +   ++    + +L    N     +  
Sbjct: 64  CVVNDLWDRDIDPEVERTRDRPLAARTLSIKVGIAVGIIALFCAAILAYYLNSLSFWLSV 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A + + LLYP +KR    PQ+VL I +   V + W A+  + S   + L   T+ W + F
Sbjct: 124 AAVPVILLYPGAKRVFPVPQLVLSIAWGFAVLISWSAVTQNISQATWLLWGATLLWTLGF 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DTVYA  D++DD+ IGVNS+A  F     L + I +   ++C       + ++   WI L
Sbjct: 184 DTVYAMSDREDDQRIGVNSSALFFGDYAPLAIGIFFLGTIICLTWLGVAIHLHLAFWITL 243

Query: 262 LIA 264
            IA
Sbjct: 244 GIA 246


>gi|221487024|gb|EEE25270.1| 4-hydroxybenzoate octaprenyltransferase, putative [Toxoplasma
           gondii GT1]
          Length = 570

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 87/280 (31%), Positives = 126/280 (45%), Gaps = 46/280 (16%)

Query: 72  VGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQ 131
           VGA++ R A C  ND  D  +D++V RT+SRPL SG+ +   AL    +   +S  LLL 
Sbjct: 270 VGAVLMRSAGCIINDFFDRKLDARVERTQSRPLASGRLSPQAALASLSVHLGLSLALLLL 329

Query: 132 FNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGA------------L 179
           FNP  +    A + +  +YP  KR    PQ VLG+ F  G  VGW A            L
Sbjct: 330 FNPPTVATALASVGLVAVYPLMKRVTYWPQFVLGLTFNWGALVGWTAVTGRRLFADSSLL 389

Query: 180 HAS--------------------FSWPA---------FFLCIGTIFWVVYFDTVYAHQDK 210
            AS                    F  P+           L +  IFW + +DT+YAHQDK
Sbjct: 390 SASEGLSAAGVSGQLGAALPSTVFGLPSTLFSLELTPILLYVSGIFWTLTYDTIYAHQDK 449

Query: 211 KDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFM-VAFCLLTV-NFFAWIGLLIALFLT 268
            DD  +G+ STA LF  +T LW      ++    + V  C  ++  ++  +GL     L 
Sbjct: 450 VDDRKVGIKSTALLFGTRTPLWTAAFSSVYAAALLGVGLCSQSLWPYYLGVGLCYGQLLA 509

Query: 269 IKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLD 308
             RI   ++   K C + F S   VG  + + ++ S  L+
Sbjct: 510 QTRI---NMDDPKACSAAFRSNQWVGATLFLGILASKLLE 546


>gi|91213563|ref|YP_543549.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli UTI89]
 gi|117626308|ref|YP_859631.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli APEC O1]
 gi|218561110|ref|YP_002394023.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli S88]
 gi|237703597|ref|ZP_04534078.1| 4-hydroxybenzoate-octaprenyltransferase [Escherichia sp. 3_2_53FAA]
 gi|118574201|sp|Q1R3P6|UBIA_ECOUT RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|166988446|sp|A1AIL7|UBIA_ECOK1 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790267|sp|B7MJ30|UBIA_ECO45 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|91075137|gb|ABE10018.1| 4-hydroxybenzoate-octaprenyltransferase [Escherichia coli UTI89]
 gi|115515432|gb|ABJ03507.1| 4-hydroxybenzoate-octaprenyltransferase [Escherichia coli APEC O1]
 gi|218367879|emb|CAR05674.1| p-hydroxybenzoate octaprenyltransferase [Escherichia coli S88]
 gi|226901509|gb|EEH87768.1| 4-hydroxybenzoate-octaprenyltransferase [Escherichia sp. 3_2_53FAA]
 gi|294489767|gb|ADE88523.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli IHE3034]
 gi|307629089|gb|ADN73393.1| 4-hydroxybenzoate octaprenyltransferase [Escherichia coli UM146]
 gi|315287868|gb|EFU47270.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli MS
           110-3]
 gi|323950416|gb|EGB46297.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli H252]
 gi|323954498|gb|EGB50282.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli H263]
          Length = 290

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 126/248 (50%), Gaps = 14/248 (5%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
            W L +++ G  + R A C  ND  D   D  V RT +RPLPSG  T  +A    V+  L
Sbjct: 46  LWILAVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVL 105

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           ISF+L+L  N   I +  A L ++ +YPF KR+   PQVVLG  F   + + + A+  S 
Sbjct: 106 ISFLLVLTLNTMTILLSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESV 165

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
               + + +  I W V +DT YA  D+ DD  IG+ STA LF    KL    + GIF + 
Sbjct: 166 PLSCWLMFLANILWAVAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKL----IIGIFQIG 221

Query: 244 FMVAFCLL-TVNFFAW-----IGLLIALFLTIKRIIALDISCSKQCC-SFFHSAGVVGIL 296
            +    ++  +N   W     I +  ALF+  +++IA   +  ++ C   F +   VG++
Sbjct: 222 VLALMAIIGELNGLGWGYYWSILVAGALFVYQQKLIA---NREREACFKAFMNNNYVGLV 278

Query: 297 ILICLIIS 304
           + + L +S
Sbjct: 279 LFLGLAMS 286


>gi|24115370|ref|NP_709880.1| 4-hydroxybenzoate octaprenyltransferase [Shigella flexneri 2a str.
           301]
 gi|30064630|ref|NP_838801.1| 4-hydroxybenzoate octaprenyltransferase [Shigella flexneri 2a str.
           2457T]
 gi|81722750|sp|Q83IP7|UBIA_SHIFL RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|24054677|gb|AAN45587.1| 4-hydroxybenzoate-octaprenyltransferase [Shigella flexneri 2a str.
           301]
 gi|30042889|gb|AAP18612.1| 4-hydroxybenzoate-octaprenyltransferase [Shigella flexneri 2a str.
           2457T]
 gi|281603475|gb|ADA76459.1| 4-hydroxybenzoate octaprenyltransferase [Shigella flexneri 2002017]
 gi|313648763|gb|EFS13203.1| 4-hydroxybenzoate polyprenyl transferase [Shigella flexneri 2a str.
           2457T]
          Length = 290

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 125/247 (50%), Gaps = 12/247 (4%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
            W + +++ G  + R A C  ND  D   D  V RT +RPLPSG  T  +A    V+  L
Sbjct: 46  LWIMAVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVL 105

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           ISF+L+L  N   I +  A L ++ +YPF KR+   PQVVLG  F   + + + A+  S 
Sbjct: 106 ISFLLVLTLNTMTILLSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESV 165

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
               + + +  I W V +DT YA  D+ DD  IG+ STA LF    KL + IL  I VL 
Sbjct: 166 PLSCWLMFLANILWAVAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQ-IGVLA 224

Query: 244 FMVAFCLLTVNFFAW-----IGLLIALFLTIKRIIALDISCSKQCC-SFFHSAGVVGILI 297
            M     L  N   W     I +  ALF+  +++IA   +  ++ C   F +   VG+++
Sbjct: 225 LMAIIGEL--NGLGWGYYWSIVVAGALFVYQQKLIA---NREREACFKAFMNNNYVGLVL 279

Query: 298 LICLIIS 304
            + L +S
Sbjct: 280 FLGLAMS 286


>gi|237831659|ref|XP_002365127.1| 4-hydroxybenzoate octaprenyltransferase, putative [Toxoplasma
           gondii ME49]
 gi|211962791|gb|EEA97986.1| 4-hydroxybenzoate octaprenyltransferase, putative [Toxoplasma
           gondii ME49]
 gi|221506707|gb|EEE32324.1| 4-hydroxybenzoate octaprenyltransferase, putative [Toxoplasma
           gondii VEG]
          Length = 575

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 87/280 (31%), Positives = 126/280 (45%), Gaps = 46/280 (16%)

Query: 72  VGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQ 131
           VGA++ R A C  ND  D  +D++V RT+SRPL SG+ +   AL    +   +S  LLL 
Sbjct: 275 VGAVLMRSAGCIINDFFDRKLDARVERTQSRPLASGRLSPQAALASLSVHLGLSLALLLL 334

Query: 132 FNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGA------------L 179
           FNP  +    A + +  +YP  KR    PQ VLG+ F  G  VGW A            L
Sbjct: 335 FNPPTVATALASVGLVAVYPLMKRVTYWPQFVLGLTFNWGALVGWTAVTGRRLFADSSLL 394

Query: 180 HAS--------------------FSWPA---------FFLCIGTIFWVVYFDTVYAHQDK 210
            AS                    F  P+           L +  IFW + +DT+YAHQDK
Sbjct: 395 SASEGLSAAGVSGQLGAALPSTVFGLPSTLFSLELTPILLYVSGIFWTLTYDTIYAHQDK 454

Query: 211 KDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFM-VAFCLLTV-NFFAWIGLLIALFLT 268
            DD  +G+ STA LF  +T LW      ++    + V  C  ++  ++  +GL     L 
Sbjct: 455 VDDRKVGIKSTALLFGTRTPLWTAAFSSVYAAALLGVGLCSQSLWPYYLGVGLCYGQLLA 514

Query: 269 IKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLD 308
             RI   ++   K C + F S   VG  + + ++ S  L+
Sbjct: 515 QTRI---NMDDPKACSAAFRSNQWVGATLFLGILASKLLE 551


>gi|220907062|ref|YP_002482373.1| 4-hydroxybenzoate polyprenyl transferase [Cyanothece sp. PCC 7425]
 gi|219863673|gb|ACL44012.1| 4-hydroxybenzoate polyprenyl transferase [Cyanothece sp. PCC 7425]
          Length = 301

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 89/286 (31%), Positives = 139/286 (48%), Gaps = 19/286 (6%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAY---PLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           L RW    G  + +LP LW+ VLA++   PL   G++            + G++ T  A 
Sbjct: 20  LLRWDKPEGRLILMLPALWAVVLASHGTPPLMLVGII------------VAGSLATSAAG 67

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  NDL D +ID  V RTR+RPL +   +    +V A++ F+ ++ L L  +P    +  
Sbjct: 68  CVVNDLWDREIDPHVERTRTRPLAAKTLSIQVGVVVALVAFVCAWGLALYLHPLSFWLCV 127

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A + + +LYP +KR    PQ+VL + +   V + W A         + L   T+ W + F
Sbjct: 128 AAVPVIVLYPLAKRVFPVPQLVLSLAWGFAVLISWTAAVNRLEPATWLLWGATLLWTLGF 187

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFMVAFCLLTVNFFAWIG 260
           DTVYA  D++DD  +GVNS+A  F   T L + + Y G   L   + +  L +N   W+ 
Sbjct: 188 DTVYAMPDREDDRRLGVNSSALFFRSLTPLVVGVCYLGTAGLLVGLGWS-LKLNIGFWLS 246

Query: 261 LLIALFLTIKRIIALDIS--CSKQCCSFFHSAGVVGILILICLIIS 304
           LLIA  L   +I  L      + +   FF     +G L+L  +I+ 
Sbjct: 247 LLIATALWSAQIFTLREQELPATRYGDFFRQNVWIGFLLLAGMIVG 292


>gi|68473193|ref|XP_719402.1| hypothetical protein CaO19.7643 [Candida albicans SC5314]
 gi|46441218|gb|EAL00517.1| hypothetical protein CaO19.7643 [Candida albicans SC5314]
 gi|238880420|gb|EEQ44058.1| para-hydroxybenzoate-polyprenyltransferase, mitochondrial precursor
           [Candida albicans WO-1]
          Length = 348

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 138/275 (50%), Gaps = 11/275 (4%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           + PY+ L R     G  L +LPC W   +A+Y +  A  L W T    + ++ VGA+V R
Sbjct: 57  VIPYLELMRLEKPVGTWLLLLPCYWGITMASYSI--AAPL-WVTTK-AIALFSVGALVMR 112

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
           GA CT ND+ D ++D+QV RT  RP+ SG+ +  QA+ +  +Q      +LL        
Sbjct: 113 GAGCTINDIWDRNLDNQVARTMERPITSGRVSVPQAVAWLGVQCFAGLAVLLSLPFECFY 172

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFS-WPAFFLCIGTIFW 197
           +G   L     YP  KRF   PQ +L I F+ G  +G+ A+ A  + W A  L I    W
Sbjct: 173 LGALSLPFVAAYPLFKRFTYYPQAMLSICFSWGCLLGFPAVGAPLNLWVAVPLFISNWIW 232

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC---FMVAFCLLTVN 254
            + +DT+YAHQDKK D   G+ STA  +  +TK    I+ G+ V     +  A  + ++ 
Sbjct: 233 CLTYDTIYAHQDKKFDIKAGIKSTALAWGDKTKP---IMKGLTVAQAGFYGFAGFMNSMG 289

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHS 289
              +I    A+     +I+ +D+   K C S F S
Sbjct: 290 PGFYIAGAYAIARLYNQILKVDLDNPKSCWSAFTS 324


>gi|291615806|ref|YP_003518548.1| UbiA [Pantoea ananatis LMG 20103]
 gi|291150836|gb|ADD75420.1| UbiA [Pantoea ananatis LMG 20103]
          Length = 294

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 91/286 (31%), Positives = 133/286 (46%), Gaps = 15/286 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  LA   +    +L          +++ G  V R A 
Sbjct: 13  YSRLMRIDKPIGALLLLWPTLWALWLAKMAVPPLHILA---------VFVAGVFVMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT+ RPL SG  T  +A    V+  LI+F L+L  N   I +  
Sbjct: 64  CVINDYADRKVDGHVERTKHRPLASGAVTAKEAKYLFVVLGLIAFALVLSMNLMTIMLSV 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++ +YPF KR+   PQVVLG  F   + + W A+  S     + + +  I W V +
Sbjct: 124 VGLALAWVYPFMKRYTHLPQVVLGAAFGWAIPMAWSAVSESLPLVCWLVFLANICWTVAY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFMVAFCLLTVNFFAWIG 260
           DT YA  D+ DD  IGV STA LF    K  + +L     VL   V   L     F W  
Sbjct: 184 DTQYAMVDRDDDLKIGVKSTAILFGRYDKFIIGLLQLATLVLMAWVGMILDLNGAFYWTL 243

Query: 261 LLI-ALFLTIKRIIALDISCSKQCC-SFFHSAGVVGILILICLIIS 304
           LL   LF+  +++IA      +Q C   F +   VG+++ + ++++
Sbjct: 244 LLAGGLFVYQQKLIA---ERDRQACFRAFLNNNYVGLVLFLGVLMN 286


>gi|15604529|ref|NP_221047.1| 4-hydroxybenzoate polyprenyltransferase [Rickettsia prowazekii str.
           Madrid E]
 gi|3861223|emb|CAA15123.1| 4-HYDROXYBENZOATE OCTAPRENYLTRANSFERASE (ubiA) [Rickettsia
           prowazekii]
 gi|292572318|gb|ADE30233.1| 4-hydroxybenzoate octaprenyltransferase [Rickettsia prowazekii
           Rp22]
          Length = 282

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 89/277 (32%), Positives = 135/277 (48%), Gaps = 10/277 (3%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           L R      + L   P L+  +LA              + + L ++I G+I  R + C  
Sbjct: 13  LMRADKPVAYLLVFFPALFGLLLAN--------PSNMELAYLLPLFIFGSITARSSGCII 64

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND+ D   D  V RT+ RPL SG  + F A+   ++  +IS  +LL  N   I  GF  +
Sbjct: 65  NDIFDRKFDKYVERTKKRPLASGAVSVFYAIFILLILSIISLSILLLLNKTAIYTGFFAV 124

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            + +LYP  KR    PQ+ LG  F  GV V +GA+       A  + +   FW + +DT+
Sbjct: 125 IMIILYPLMKRITYFPQIFLGFTFKLGVLVAYGAVQDKLDTEAIIMYLACCFWAIGYDTI 184

Query: 205 YAHQDKKDDELIGVNS-TARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLI 263
           Y + D KDD+ IGV S +  L +   K WL+I Y  F+L F++A  +   N   ++ +L 
Sbjct: 185 YGYMDIKDDKKIGVKSLSIYLENKNPKFWLYICYIGFILLFILATKIANFN-IDYLPVLA 243

Query: 264 ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILIC 300
           AL L I +I  LDI     C   F +   VG+L+++ 
Sbjct: 244 ALILLILQIATLDIKNPVNCIKRFSANNYVGVLLIMA 280


>gi|116053505|ref|YP_793832.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|122256474|sp|Q02E04|UBIA_PSEAB RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|115588726|gb|ABJ14741.1| 4-hydroxybenzoate polyprenyltransferase [Pseudomonas aeruginosa
           UCBPP-PA14]
          Length = 296

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 112/211 (53%), Gaps = 11/211 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           +V L R     G +L + P LWS  +AA      GV         L I+++G I+ R A 
Sbjct: 19  FVQLVRLDRPIGIYLLLWPTLWSLWIAA-----DGVPELKN----LLIFVLGVILMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLISFVLLLQFNPFVICVG 140
           C  ND  D + D  V RT++RPL +G+ +  +A + FAVL  L SF L+L  N   + + 
Sbjct: 70  CVINDFADRNFDGHVARTKARPLATGKISVREAWITFAVLVAL-SFGLVLLTNATTVWLS 128

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
           F  + ++ LYPF KR+   PQVVLG  ++ G+ + + A        A+ L +  + W V 
Sbjct: 129 FGAVAVASLYPFMKRYTYYPQVVLGAAYSWGILMAFTAERGELPASAWLLFLANVLWTVA 188

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
           +D+ YA  D++DD  IG+ STA LF    +L
Sbjct: 189 YDSYYAMTDREDDLKIGIKSTAILFGDADRL 219


>gi|308188948|ref|YP_003933079.1| 4-hydroxybenzoate octaprenyltransferase [Pantoea vagans C9-1]
 gi|308059458|gb|ADO11630.1| 4-hydroxybenzoate octaprenyltransferase [Pantoea vagans C9-1]
          Length = 288

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 139/286 (48%), Gaps = 15/286 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  LA   +    VL          +++ G  V R A 
Sbjct: 7   YARLMRIDKPIGTLLLMWPTLWALWLADMAIPPLPVL---------VVFVAGVFVMRAAG 57

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT+ RPL SG  +  +A +  V+  L++F L+L  N   I +  
Sbjct: 58  CVINDYADRKVDGHVERTKHRPLASGAVSAKEAKLLFVILALVAFALVLSMNLMTIMLSV 117

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++ +YPF KR+   PQVVLG  F   + + W A+  S     + + I  I W V +
Sbjct: 118 VGLALAWVYPFMKRYTHLPQVVLGAAFGWAIPMAWSAVSESLPLVCWLVFIANICWTVAY 177

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN-FFAWIG 260
           DT YA  D+ DD  IGV STA LF    KL + +L    +L   +   +L +N  F W  
Sbjct: 178 DTQYAMVDRDDDLKIGVKSTAILFGRFDKLIIGLLQLATLLLMALVGMMLHLNGAFYWTL 237

Query: 261 LL-IALFLTIKRIIALDISCSKQCC-SFFHSAGVVGILILICLIIS 304
           LL  ALF+  +++IA      +Q C   F +   VG+++ + ++++
Sbjct: 238 LLAAALFVYQQKLIA---GRERQPCFQAFLNNNYVGMVLFLGVLMN 280


>gi|238492072|ref|XP_002377273.1| para-hydroxybenzoate-polyprenyltransferase Coq2, putative
           [Aspergillus flavus NRRL3357]
 gi|220697686|gb|EED54027.1| para-hydroxybenzoate-polyprenyltransferase Coq2, putative
           [Aspergillus flavus NRRL3357]
          Length = 484

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/234 (33%), Positives = 115/234 (49%), Gaps = 25/234 (10%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAA-----YPLRRAGVLGWSTIFWYLFIYIVGAI 75
           PY  L R    TG +    PC +ST+LAA      P +  G +G         +++ GA+
Sbjct: 114 PYAELIRLDKPTGTYYLFFPCAFSTLLAAPMTSSTPFQVLGTMG---------LFLAGAL 164

Query: 76  VTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPF 135
           V RGA CT NDL D ++D  V RT+ RP+     +  +A+VF  +Q L    +LLQF   
Sbjct: 165 VMRGAGCTINDLWDRNLDPHVERTKFRPIARRAVSPRKAVVFTGMQLLAGLGILLQFPTL 224

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL-------HASFSWPAF 188
            +  G   L +   YP +KR    PQ VLG+ F+ G  +G+ AL       H++    A 
Sbjct: 225 CLWYGIPSLLLVTTYPLAKRITYYPQAVLGLTFSWGAMMGFPALGIDLLSNHSALE-SAA 283

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVL 242
            L    + W + +D +YAH D KDD   G+ S A    + TK    +L G+ V+
Sbjct: 284 ALYSSCVAWTILYDMIYAHMDIKDDVAAGIKSIALRHEHNTKT---VLSGLAVV 334


>gi|109896398|ref|YP_659653.1| 4-hydroxybenzoate polyprenyl transferase [Pseudoalteromonas
           atlantica T6c]
 gi|109698679|gb|ABG38599.1| 4-hydroxybenzoate octaprenyltransferase [Pseudoalteromonas
           atlantica T6c]
          Length = 273

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 140/275 (50%), Gaps = 17/275 (6%)

Query: 27  RWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWND 86
           R     G +L + P LW+ ++AA  L    + G         I++ G  V R A C  ND
Sbjct: 2   RADKPVGSYLLLWPTLWALMIAAQGLPPWHITG---------IFMAGVFVMRSAGCVIND 52

Query: 87  LVDHDIDSQVLRTRSRPLPSGQCTRFQAL-VFAVLQFLISFVLLLQFNPFVICVGFALLF 145
             D  +D +V RT++RPL SG  T  QAL +FA L   ++F+L+L  N   I +    L 
Sbjct: 53  YADRKVDGKVDRTKARPLVSGVVTEKQALGLFATL-VGVAFLLVLALNWQTIVLSLGALA 111

Query: 146 ISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVY 205
           ++ +YPF KR+   PQVVLG  F   + + + A+  +    A++L    + W V +DT Y
Sbjct: 112 LASVYPFMKRYTHFPQVVLGAAFGWAIPMAFMAVTEAVPAIAWWLFAINVLWTVAYDTQY 171

Query: 206 AHQDKKDDELIGVNSTARLFSYQTKL--WLFILYGIFVLCFMVAFCLLTVNFFAWIGLLI 263
           A  D+ DD  IGV STA LF    +L   L  L  + +L  M  +   T++F+  + L  
Sbjct: 172 AMVDRNDDLQIGVKSTAVLFGQYDRLIIGLLQLSVVVMLLGMGQYLGFTLSFYVGVLLAS 231

Query: 264 ALFLTIKRIIALDISCSKQCC-SFFHSAGVVGILI 297
            LF+  +R+I+     ++Q C S F +   VG+ I
Sbjct: 232 VLFIHQQRLIS---GRARQACFSAFLNNNYVGMAI 263


>gi|118574235|sp|Q9PH76|UBIA_XYLFA RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
          Length = 299

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 86/281 (30%), Positives = 128/281 (45%), Gaps = 9/281 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           + + PY  LAR     G+ L + P  W+  LAA      GV  W    W L ++  G  +
Sbjct: 18  NRLDPYWKLARGDRPVGFLLLLWPTWWALWLAA-----GGVPPW----WTLCVFTTGIWL 68

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
           TR A C  ND  D  +D  V RTR RPL +G  +   AL+      LI+F L+L  N   
Sbjct: 69  TRSAGCVINDYTDRWLDPHVERTRIRPLVTGAVSPRNALLMFATLMLIAFGLVLTMNQLT 128

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           + +    LF+++ YP+ KR+   PQV LG+ F  G+ + + A+       A+ L +  I 
Sbjct: 129 VLLSVVGLFLAMTYPYLKRYTYLPQVYLGLAFGWGIPMAFAAIQGKVPTQAWLLYVANIL 188

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
           W   +DT  A  D+ DD  +G  STA LF+        +LY + +    +     T++  
Sbjct: 189 WTTAYDTWCAMVDRDDDIKMGAKSTAILFADLDLTVQGVLYTLMLFTLCLVGLRATLSHT 248

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
            WI L+ A+ L   + I         C   F     VG+ I
Sbjct: 249 YWISLIAAVALIGYQFIIARRREPTACFRAFMHNNWVGMTI 289


>gi|152985707|ref|YP_001351451.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas aeruginosa
           PA7]
 gi|167011553|sp|A6VEG6|UBIA_PSEA7 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|150960865|gb|ABR82890.1| 4-hydroxybenzoate polyprenyl transferase [Pseudomonas aeruginosa
           PA7]
          Length = 296

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 107/210 (50%), Gaps = 9/210 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           +V L R     G +L + P LWS  +AA         G       L I+++G  + R A 
Sbjct: 19  FVQLVRLDRPIGIYLLLWPTLWSLWIAA---------GGVPELKNLLIFVLGVTLMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D D D  V RT++RPL +G+ +  +A +   +   +SF L+L  N   I + F
Sbjct: 70  CVINDFADRDFDGHVARTKARPLATGKISVREAWITFTILVALSFGLVLLTNAPTIWLSF 129

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + ++ LYPF KR+   PQVVLG  ++ G+ + + A        A+ L +  + W V +
Sbjct: 130 GAVAVASLYPFMKRYTYYPQVVLGAAYSWGILMAFTAERGELPASAWLLFLANVLWTVAY 189

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
           D+ YA  D++DD  IG+ STA LF    +L
Sbjct: 190 DSYYAMTDREDDLKIGIKSTAILFGDADRL 219


>gi|90415368|ref|ZP_01223302.1| 4-hydroxybenzoate octaprenyl transferase [marine gamma
           proteobacterium HTCC2207]
 gi|90332691|gb|EAS47861.1| 4-hydroxybenzoate octaprenyl transferase [marine gamma
           proteobacterium HTCC2207]
          Length = 288

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 84/288 (29%), Positives = 130/288 (45%), Gaps = 9/288 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           P++ L R     G +L + P LW+   A+         G       L I+++G +V R A
Sbjct: 9   PWLRLTRLDKPIGTYLLLWPTLWALWFAS---------GGQPRIENLLIFVLGVVVMRAA 59

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C  ND  D  +D +V RTR RPLPSG+     AL    +   ++ +L+L  N   I + 
Sbjct: 60  GCVINDYADRHVDGEVERTRYRPLPSGEIRAGTALALFFVLLGVALILVLMTNQLTIMLA 119

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
           F     + LYPF KR    PQ+ LGI +A    + + A ++      + + +  + W + 
Sbjct: 120 FGGAAATTLYPFLKRITHWPQLGLGIAWAWSTPMAFAAHNSQLPPQLWVVFVAIVLWTIA 179

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           FDT YA  D++DD  IG+ STA LF     L + +L    VL    A  L       ++G
Sbjct: 180 FDTYYAMVDREDDLRIGIKSTAILFGRYDLLIVGLLQFAVVLLMATAGILFDRGLIYFVG 239

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLD 308
           L +A    + + +         C   F +   VG++I I L     L+
Sbjct: 240 LAVAAGYFVNQHLVSRGRNRDACFKAFLNNHRVGMIIFIGLASDYLLN 287


>gi|323174433|gb|EFZ60058.1| 4-hydroxybenzoate polyprenyl transferase [Escherichia coli LT-68]
          Length = 290

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 125/247 (50%), Gaps = 12/247 (4%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
            W L +++ G  + R A C  ND  D   D  V RT +RPLPSG  T  +A    ++  L
Sbjct: 46  LWILAVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFIVLVL 105

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           ISF+L+L  N   I +  A L ++ +YPF KR+   PQVVLG  F   + + + A+  S 
Sbjct: 106 ISFLLVLTLNTMTILLSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESV 165

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
               + + +  I W V +DT YA  D+ DD  IG+ STA LF    KL + IL  I VL 
Sbjct: 166 PLSCWLMFLANILWAVAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQ-IGVLA 224

Query: 244 FMVAFCLLTVNFFAW-----IGLLIALFLTIKRIIALDISCSKQCC-SFFHSAGVVGILI 297
            M     L  N   W     I +  ALF+  +++IA   +  ++ C   F +   VG+++
Sbjct: 225 LMAIIGEL--NGLGWGYYWSILVAGALFVYQQKLIA---NREREACFKAFMNNNYVGLVL 279

Query: 298 LICLIIS 304
            + L +S
Sbjct: 280 FLGLAMS 286


>gi|302548518|ref|ZP_07300860.1| 4-hydroxybenzoate polyprenyl transferase [Streptomyces
           hygroscopicus ATCC 53653]
 gi|302466136|gb|EFL29229.1| 4-hydroxybenzoate polyprenyl transferase [Streptomyces
           himastatinicus ATCC 53653]
          Length = 271

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 84/275 (30%), Positives = 130/275 (47%), Gaps = 11/275 (4%)

Query: 29  HSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLV 88
           H+  G  L +LP LW   LA+     +G   W     ++  + VGA++ RG  CT NDL 
Sbjct: 2   HAPIGSWLYLLPGLWGIALAS-----SGPPDWR----HVLPFAVGAVLVRGFGCTVNDLA 52

Query: 89  DHDIDSQVLRTRSRPLPSGQCT-RFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFIS 147
           D ++D++V RT +RP+P+G  T     +   V       VL +   P  + V  +   + 
Sbjct: 53  DREVDARVARTVARPIPAGTVTVAGALVFAVVQAVAALLVLAVASVPAAVLVAASYPLV- 111

Query: 148 LLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYAH 207
           + YPF KR    PQ  LG+ F   +  GW A+      PA  L +   FW + +DT+YAH
Sbjct: 112 VAYPFMKRITYWPQAWLGMVFGCYILAGWLAVAGRIETPALLLYVAGFFWTLGYDTIYAH 171

Query: 208 QDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIALFL 267
           QDK DD  +GV S A      T+ W+   YG  V+  + A  +  +++  +   L  +  
Sbjct: 172 QDKADDVQVGVKSLALRLGGATRPWVAGFYGATVVGIVAAGAVAGLHWTFYALFLPGVAQ 231

Query: 268 TIKRIIALDISCSKQCCSFFHSAGVVGILILICLI 302
              ++ A+DI     C   F S    G L L+ ++
Sbjct: 232 LFWQVAAVDIDDPADCREKFVSNRFFGWLALVAIV 266


>gi|307296238|ref|ZP_07576065.1| 4-hydroxybenzoate polyprenyl transferase [Sphingobium
           chlorophenolicum L-1]
 gi|306878040|gb|EFN09263.1| 4-hydroxybenzoate polyprenyl transferase [Sphingobium
           chlorophenolicum L-1]
          Length = 304

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 92/167 (55%), Gaps = 8/167 (4%)

Query: 60  WSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAV 119
           W  I W L     G+I  RGA C +ND+VD D+D QV RT SRPL SG  +   A V+ +
Sbjct: 58  WPLILWLLL----GSIAMRGAGCVFNDIVDRDLDRQVARTASRPLASGAVSVKTAWVWLL 113

Query: 120 LQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL 179
              LI  V+LLQ + +   V    L +   YPF KR    PQ+ LG+ F+    VGW  +
Sbjct: 114 ALCLIGLVVLLQLHLYAQAVSLGSLALVAAYPFMKRITGWPQIWLGLVFSWAALVGWSEV 173

Query: 180 HASFSWPAFFLCIGT----IFWVVYFDTVYAHQDKKDDELIGVNSTA 222
             S +  A    +      IFWVV +DT+YA QD++DD LIG+ S+A
Sbjct: 174 AGSLTLSALGPGLLLYGGCIFWVVGYDTIYALQDREDDALIGIGSSA 220


>gi|70991537|ref|XP_750617.1| 4-hydroxybenzoate polyprenyl transferase [Aspergillus fumigatus
           Af293]
 gi|66848250|gb|EAL88579.1| 4-hydroxybenzoate polyprenyl transferase, putative [Aspergillus
           fumigatus Af293]
 gi|159124174|gb|EDP49292.1| 4-hydroxybenzoate polyprenyl transferase, putative [Aspergillus
           fumigatus A1163]
          Length = 339

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 88/267 (32%), Positives = 121/267 (45%), Gaps = 30/267 (11%)

Query: 21  PYVYLARWHSSTG-----WHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAI 75
           PY  L R     G     WH  +   L + + +  P      L   ++F +  +++   I
Sbjct: 39  PYAELMRLDRPAGYWAFYWHFVIGLTLAANMSSPIP----SPLTLVSLFLFFAVWV---I 91

Query: 76  VTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPF 135
           + RGA CTWND +D D D +V RTR+RP+P G  T  Q  +F + Q  +   +LL     
Sbjct: 92  ILRGAVCTWNDTLDQDFDRKVSRTRNRPIPRGAVTTIQGHLFTLAQIALGTAMLLPLPLG 151

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP--------- 186
            +     +  I L+YP  KR    PQV+LGI F   +FV   AL A    P         
Sbjct: 152 CMYRAALMTAILLVYPLGKRVTDFPQVILGIAFGMSIFVCSAALDAD-PHPLLGTETDDL 210

Query: 187 ----AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVL 242
               A    I +I W   FDT+YAHQD KDD  +GV S A     +TK  L +L    V+
Sbjct: 211 RLVTALCFYIASILWTAIFDTIYAHQDAKDDAKVGVRSLAVRLGDRTKHTLSVLAATQVM 270

Query: 243 CFMVA--FCLLTVNFFAW--IGLLIAL 265
               A   C  +  +FA   IG  I+L
Sbjct: 271 LLFAAGIACNFSAIYFAGSCIGTAISL 297


>gi|261855618|ref|YP_003262901.1| 4-hydroxybenzoate polyprenyl transferase [Halothiobacillus
           neapolitanus c2]
 gi|261836087|gb|ACX95854.1| 4-hydroxybenzoate polyprenyl transferase [Halothiobacillus
           neapolitanus c2]
          Length = 290

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 91/286 (31%), Positives = 138/286 (48%), Gaps = 11/286 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L R +   G +L + P  W+  LAA      GV  W      L I+ +G +V R A 
Sbjct: 15  YIALTRLNRPIGIYLLLWPTWWALWLAA-----GGVPDWR----LLLIFTLGVVVMRSAG 65

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT++RPL +G     +A+   V   L+  VL+LQ N   I +  
Sbjct: 66  CAINDYADRHVDGHVARTKNRPLAAGLIQPSEAVGVFVFLSLVGLVLVLQLNTTTILLSI 125

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KRF   PQV LG+ F   + + + A   +     + L I  +FW V +
Sbjct: 126 VALILAATYPFGKRFHHLPQVQLGMAFGWAIPMAFAAQTGTVPLIGWLLFIANMFWTVAY 185

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLT-VNFFAWIG 260
           DT+YA  D++DD  +GV STA LF     L +  LY +  L  ++  C++     F +I 
Sbjct: 186 DTLYAMADREDDLKVGVKSTAVLFGRFDLLIVSALY-VATLATLILICVIQGFGLFPFIA 244

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
           LL+A    +  + +        C   F    V G L++I L+++ F
Sbjct: 245 LLLAAISAVWIVYSARDRDPAHCVRAFLRNNVFGALVMIALLLAYF 290


>gi|296392218|ref|ZP_06881693.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas aeruginosa
           PAb1]
 gi|313106785|ref|ZP_07793000.1| 4-hydroxybenzoate-octaprenyl transferase [Pseudomonas aeruginosa
           39016]
 gi|310879502|gb|EFQ38096.1| 4-hydroxybenzoate-octaprenyl transferase [Pseudomonas aeruginosa
           39016]
          Length = 296

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 112/211 (53%), Gaps = 11/211 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           +V L R     G +L + P LWS  +AA      GV         L I+++G I+ R A 
Sbjct: 19  FVQLVRLDRPIGIYLLLWPTLWSLWIAA-----DGVPELKN----LLIFVLGVILMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLISFVLLLQFNPFVICVG 140
           C  ND  D + D  V RT++RPL +G+ +  +A + FAVL  L SF L+L  N   + + 
Sbjct: 70  CVINDFADRNFDGHVARTKARPLATGKISVREAWITFAVLVAL-SFGLVLLTNATTVWLS 128

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
           F  + ++ LYPF KR+   PQVVLG  ++ G+ + + A        A+ L +  + W V 
Sbjct: 129 FGAVAVASLYPFMKRYTYYPQVVLGAAYSWGILMAFTAERGELPASAWLLFLANVLWTVA 188

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
           +D+ YA  D++DD  IG+ STA LF    +L
Sbjct: 189 YDSYYAMTDREDDLKIGIKSTAILFGDADRL 219


>gi|15600551|ref|NP_254045.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas aeruginosa
           PAO1]
 gi|107104460|ref|ZP_01368378.1| hypothetical protein PaerPA_01005537 [Pseudomonas aeruginosa PACS2]
 gi|218894461|ref|YP_002443331.1| 4-hydroxybenzoate octaprenyltransferase [Pseudomonas aeruginosa
           LESB58]
 gi|254237951|ref|ZP_04931274.1| 4-hydroxybenzoate-octaprenyl transferase [Pseudomonas aeruginosa
           C3719]
 gi|254243757|ref|ZP_04937079.1| 4-hydroxybenzoate-octaprenyl transferase [Pseudomonas aeruginosa
           2192]
 gi|81539465|sp|Q9HTK0|UBIA_PSEAE RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790282|sp|B7V5P9|UBIA_PSEA8 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|9951678|gb|AAG08743.1|AE004947_13 4-hydroxybenzoate-octaprenyl transferase [Pseudomonas aeruginosa
           PAO1]
 gi|126169882|gb|EAZ55393.1| 4-hydroxybenzoate-octaprenyl transferase [Pseudomonas aeruginosa
           C3719]
 gi|126197135|gb|EAZ61198.1| 4-hydroxybenzoate-octaprenyl transferase [Pseudomonas aeruginosa
           2192]
 gi|218774690|emb|CAW30507.1| 4-hydroxybenzoate-octaprenyl transferase [Pseudomonas aeruginosa
           LESB58]
          Length = 296

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 112/211 (53%), Gaps = 11/211 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           +V L R     G +L + P LWS  +AA      GV         L I+++G I+ R A 
Sbjct: 19  FVQLVRLDRPIGIYLLLWPTLWSLWIAA-----DGVPELKN----LLIFVLGVILMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLISFVLLLQFNPFVICVG 140
           C  ND  D + D  V RT++RPL +G+ +  +A + FAVL  L SF L+L  N   + + 
Sbjct: 70  CVINDFADRNFDGHVARTKARPLATGKISVREAWITFAVLVAL-SFGLVLLTNATTVWLS 128

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
           F  + ++ LYPF KR+   PQVVLG  ++ G+ + + A        A+ L +  + W V 
Sbjct: 129 FGAVAVASLYPFMKRYTYYPQVVLGAAYSWGILMAFTAERGELPASAWLLFLANVLWTVA 188

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
           +D+ YA  D++DD  IG+ STA LF    +L
Sbjct: 189 YDSYYAMTDREDDLKIGIKSTAILFGDADRL 219


>gi|332139478|ref|YP_004425216.1| 4-hydroxybenzoate octaprenyltransferase [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327549500|gb|AEA96218.1| 4-hydroxybenzoate octaprenyltransferase [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 286

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 81/286 (28%), Positives = 134/286 (46%), Gaps = 9/286 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G +L + P LW+ ++AA  L    +           I++ G +V R A 
Sbjct: 8   YAQLMRLDKPVGIYLLLWPTLWALLMAAQGLPPLEIT---------VIFVAGVVVMRSAG 58

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D ++D +V RT  R L +G+ T  QAL       +I+F+L+L  N   I +  
Sbjct: 59  CVINDYADRNVDGRVKRTTQRLLATGEATPKQALQLFGALIVIAFILVLFLNWQTIALSV 118

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F   + + + A+  +    A++L I  + W V +
Sbjct: 119 VALMLAASYPFMKRYTHLPQVVLGAAFGWSIPMAFMAVQETVPTYAWWLFIANLLWTVAY 178

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT+YA  D+ DD  IGV STA LF     L + +L    ++      C +   +  +  +
Sbjct: 179 DTMYAMVDRDDDLQIGVKSTAILFGKNDVLIVMLLQACALIILWCIGCTINATWPYYTAV 238

Query: 262 LIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
           L +  L +++   +     + C + F     +G+ I +   +  +L
Sbjct: 239 LFSALLCVRQYQLIKRRQREGCFTAFIENHYIGLAITLGTALHFYL 284


>gi|255710971|ref|XP_002551769.1| KLTH0A07150p [Lachancea thermotolerans]
 gi|238933146|emb|CAR21327.1| KLTH0A07150p [Lachancea thermotolerans]
          Length = 368

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 105/211 (49%), Gaps = 6/211 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L  +PC W+  +AA       +   S+  W L ++ VG++V RGA
Sbjct: 78  PYAELMRLEKPVGTWLLYIPCTWAISMAAMET----MAPISSAMWMLSLFGVGSLVMRGA 133

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL+D ++D +V+R+  RP+ SG+ +  QA+ F   Q      +L Q       +G
Sbjct: 134 GCTINDLLDRNLDDKVIRSVERPIASGRVSPKQAVAFLGAQTAGGMGILTQLPAECWWLG 193

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF-LCIGTIFWVV 199
            A L +   YP  KRF   PQ  L   F  G  +G+ A+     WP    L   +  W +
Sbjct: 194 LASLPLVFTYPLFKRFTYYPQAALSACFTWGALLGFPAMGV-MDWPTMIPLYTSSFLWCM 252

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
            +DT+YAHQDK  D   G+ STA  +  +T+
Sbjct: 253 TYDTIYAHQDKSFDVKAGIKSTALAWGPKTR 283


>gi|254515857|ref|ZP_05127917.1| 4-hydroxybenzoate polyprenyl transferase [gamma proteobacterium
           NOR5-3]
 gi|219675579|gb|EED31945.1| 4-hydroxybenzoate polyprenyl transferase [gamma proteobacterium
           NOR5-3]
          Length = 296

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/178 (36%), Positives = 99/178 (55%), Gaps = 3/178 (1%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L I+ +G ++ R + C  NDL D ++D  V RTR+RPL +G  T  +AL F V+  L++F
Sbjct: 54  LVIFALGTLLMRSSGCIINDLADRNLDGGVERTRNRPLVTGDVTVVEALAFFVVLCLLAF 113

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
            L+L  N   I +    L ++  YP  KR+   PQVVLG+ F+  + + + A   S   P
Sbjct: 114 GLVLMTNLLTILLSVPALLLASCYPLMKRYTHLPQVVLGLAFSWSIPMAFAAQQGSLPAP 173

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCF 244
            + L  G++ W V +DT YA  D+++D  IG+ STA LF    +  + +L    VLC 
Sbjct: 174 LWLLFTGSVLWTVVYDTKYAMVDRRNDLEIGIKSTAILFGESDRSVIAVLQ---VLCL 228


>gi|189037055|sp|A5CXV6|UBIA_VESOH RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
          Length = 273

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/200 (33%), Positives = 108/200 (54%), Gaps = 9/200 (4%)

Query: 27  RWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWND 86
           R  +  G +L + P LW+  LA+       +L          I+++G ++ R A C  ND
Sbjct: 2   RLDNPIGIYLLLWPTLWALFLASEGFPDLKLL---------LIFVLGVVLMRSAGCVIND 52

Query: 87  LVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFI 146
             D  ID  V RT+ RP+ SG+     AL F VL  +++F+L+L  N   I +    + +
Sbjct: 53  YADRYIDKLVERTKHRPITSGEIHHRSALKFFVLLIMLAFLLVLLTNWLTIQLAMIAVLL 112

Query: 147 SLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYA 206
           ++LYPF+KR+   PQ VLG+ FA  V + + A        A+++   T+ W V +DT+YA
Sbjct: 113 AILYPFTKRWTYFPQFVLGLAFAMSVLMAFSATLNEIPITAWYVFAATVIWTVIYDTMYA 172

Query: 207 HQDKKDDELIGVNSTARLFS 226
             D+++D  IG+ S+A LF+
Sbjct: 173 MADREEDLKIGIKSSAILFA 192


>gi|146423625|ref|XP_001487739.1| hypothetical protein PGUG_01116 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 380

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 115/217 (52%), Gaps = 5/217 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L +LP  W   +AAY +  A VL   T    + ++ +GA+V RGA
Sbjct: 89  PYAELMRLEKPVGTLLLLLPSFWGITMAAYGIG-APVL---TTLKVVSLFSIGALVMRGA 144

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL+D D+D++V RT  RP+ SG+ +  QA+ F  +Q      +LL        +G
Sbjct: 145 GCTINDLLDRDLDNKVARTMERPIASGRVSVPQAITFLGVQCFAGLGVLLSLPFECFYLG 204

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFS-WPAFFLCIGTIFWVV 199
              L     YP  KRF   PQ +L I F+ G  +G+ A+ A  + + A  L I    W +
Sbjct: 205 ALSLPFVAAYPLFKRFTYYPQAMLSICFSWGCLLGFPAVGAPLNLFVAVPLFISNFLWCM 264

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFIL 236
            +DT+YAHQDKK D   G+ STA  +  +++ ++ +L
Sbjct: 265 IYDTIYAHQDKKFDISAGIKSTALKWGDKSRPYMNVL 301


>gi|332108478|gb|EGJ09702.1| 4-hydroxybenzoate polyprenyl transferase [Rubrivivax
           benzoatilyticus JA2]
          Length = 294

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 116/232 (50%), Gaps = 16/232 (6%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L RW    GW L     LW T LAA  +   G  G   I     ++ +G ++ R A 
Sbjct: 10  YLDLIRWDRPAGWLL----LLWPT-LAALWIAADGFPGLHLIA----VFTLGTVLMRSAG 60

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND+ D + D  V RT  RP+ SG      AL        +SF+L+L  NP  I + F
Sbjct: 61  CCINDVADREFDRHVKRTAQRPITSGALGVPDALGVGAALAFVSFLLVLTTNPPTILLSF 120

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW-------PAFFLCIGT 194
             L ++L+YP++KRF+  PQ VLG+ F+ G+ + + A      W        A++L +G 
Sbjct: 121 FGLAVTLVYPYAKRFVSMPQAVLGVAFSFGIPMAFAAAQGGQEWTFAAVPPQAWWLLVGN 180

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV 246
           +FWV+ +DT YA  D+ DD  IG+ ++A          +   YG+F+  + V
Sbjct: 181 LFWVLAYDTEYAMVDRDDDLKIGIKTSAITLGRFDVAGIMAFYGLFLAIWAV 232


>gi|15836673|ref|NP_297361.1| 4-hydroxybenzoate octaprenyltransferase [Xylella fastidiosa 9a5c]
 gi|9104838|gb|AAF82881.1|AE003860_8 hydroxybenzoate octaprenyltransferase [Xylella fastidiosa 9a5c]
          Length = 333

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 86/281 (30%), Positives = 128/281 (45%), Gaps = 9/281 (3%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           + + PY  LAR     G+ L + P  W+  LAA      GV  W    W L ++  G  +
Sbjct: 52  NRLDPYWKLARGDRPVGFLLLLWPTWWALWLAA-----GGVPPW----WTLCVFTTGIWL 102

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
           TR A C  ND  D  +D  V RTR RPL +G  +   AL+      LI+F L+L  N   
Sbjct: 103 TRSAGCVINDYTDRWLDPHVERTRIRPLVTGAVSPRNALLMFATLMLIAFGLVLTMNQLT 162

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           + +    LF+++ YP+ KR+   PQV LG+ F  G+ + + A+       A+ L +  I 
Sbjct: 163 VLLSVVGLFLAMTYPYLKRYTYLPQVYLGLAFGWGIPMAFAAIQGKVPTQAWLLYVANIL 222

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFF 256
           W   +DT  A  D+ DD  +G  STA LF+        +LY + +    +     T++  
Sbjct: 223 WTTAYDTWCAMVDRDDDIKMGAKSTAILFADLDLTVQGVLYTLMLFTLCLVGLRATLSHT 282

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
            WI L+ A+ L   + I         C   F     VG+ I
Sbjct: 283 YWISLIAAVALIGYQFIIARRREPTACFRAFMHNNWVGMTI 323


>gi|238794671|ref|ZP_04638276.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia intermedia ATCC
           29909]
 gi|238725977|gb|EEQ17526.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia intermedia ATCC
           29909]
          Length = 292

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 141/299 (47%), Gaps = 17/299 (5%)

Query: 12  DCIMGSAIA----PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
           D + GS +      Y  L R     G  L + P LW+  LA   +    +L         
Sbjct: 2   DKLKGSTVQTKWQAYCRLMRIDKPIGSLLLLWPTLWALWLAGQGIPETKIL--------- 52

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
            ++++G    R A C  ND  D +ID  V RT SRPLPSG  +  ++ +  V+  L+SF 
Sbjct: 53  IVFVLGVFFMRAAGCVVNDYADRNIDGFVKRTASRPLPSGIISERESKILFVVLVLLSFG 112

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           L+L  N   I +  A L ++  YPF KR    PQVVLG  F   + +G+ AL  S     
Sbjct: 113 LVLTLNSMTIWLSLAALALAWTYPFMKRVTHLPQVVLGAAFGWSIPMGFAALSESLPLVC 172

Query: 188 FFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFMV 246
           + L +  I W V +DT YA  D+ DD  IGV STA LF    KL + +L     VL   +
Sbjct: 173 WLLLLANICWTVAYDTQYAMVDRDDDLKIGVKSTAILFGQHDKLIIGLLQLATLVLMVAI 232

Query: 247 AFCLLTVNFFAWIGLLI-ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            + +     F W  LL  ALF+  +++I         C   F +   VG+++ + ++IS
Sbjct: 233 GWLMGLGGAFYWSILLAGALFIHQQKMITQ--RDRDACFRAFLNNNYVGLVLFLGILIS 289


>gi|186477267|ref|YP_001858737.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia phymatum
           STM815]
 gi|254790262|sp|B2JGG3|UBIA_BURP8 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|184193726|gb|ACC71691.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia phymatum
           STM815]
          Length = 287

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 107/203 (52%), Gaps = 10/203 (4%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L I+ +G I+ R A C  ND  D D D  V RT +RP+ SG+   ++A+  A    L++F
Sbjct: 44  LVIFALGTILMRSAGCAINDYADRDFDRYVKRTENRPITSGKIKAWEAVALAAGLSLVAF 103

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+L  N     +  A LF++  YPF+KRF   PQ  LGI F  G+ + + A+       
Sbjct: 104 LLILPLNALTKELSVAALFVAGTYPFTKRFFAIPQAYLGIAFGFGIPMAFAAVQNQVPLL 163

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY----GIFV- 241
           A+ + I  +FW V +DT YA  D+ DD  IG+ ++A  F     L + + Y    GI+V 
Sbjct: 164 AWVMLIANVFWSVAYDTEYAMVDRDDDIKIGIRTSALTFGRFDVLAIMLCYAVTLGIYVG 223

Query: 242 LCFMVAFCLLTVNFFAWIGLLIA 264
           + F + F +L      WIGL  A
Sbjct: 224 IGFTLGFGVLY-----WIGLAAA 241


>gi|302498262|ref|XP_003011129.1| UbiA prenyltransferase family protein [Arthroderma benhamiae CBS
           112371]
 gi|291174677|gb|EFE30489.1| UbiA prenyltransferase family protein [Arthroderma benhamiae CBS
           112371]
          Length = 433

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 111/211 (52%), Gaps = 14/211 (6%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R    TG +    PCL+ST+LAA PL          + W+  ++  GA+V RGA
Sbjct: 124 PYAELIRLDKPTGTYYLYFPCLFSTLLAA-PLAMPMATPLE-VAWFSGLFFAGALVMRGA 181

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL D ++D  V RT+ RP+     T   A+VF   Q L    +LLQF PF  C  
Sbjct: 182 GCTINDLWDRNLDPHVERTKFRPIARRAITPKHAIVFTGAQLLSGLAILLQF-PFE-CFW 239

Query: 141 FA---LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHAS-FSWPAFFLCIGTIF 196
           +A   LLF++  YP +KR    PQ +LG+ F+ G  +G+ AL     S P+      +++
Sbjct: 240 YATPSLLFVA-AYPLAKRVTNYPQAILGLTFSWGAVMGFPALGVEVLSDPSILAACASLY 298

Query: 197 -----WVVYFDTVYAHQDKKDDELIGVNSTA 222
                W + +DT+YAH D KDD   G+ S A
Sbjct: 299 ASNVAWTILYDTIYAHMDVKDDAKAGIKSIA 329


>gi|217969255|ref|YP_002354489.1| 4-hydroxybenzoate octaprenyltransferase [Thauera sp. MZ1T]
 gi|217506582|gb|ACK53593.1| 4-hydroxybenzoate polyprenyl transferase [Thauera sp. MZ1T]
          Length = 292

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/249 (31%), Positives = 114/249 (45%), Gaps = 1/249 (0%)

Query: 59  GWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFA 118
           GW  +   L I+IVG  + R A C  ND  D D D  V RTR+RPL +G  +  +AL  A
Sbjct: 43  GWPPLH-ILVIFIVGTFLMRSAGCVINDYADRDFDGHVERTRTRPLATGVVSPGEALALA 101

Query: 119 VLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGA 178
                 +FVL+L  N   I +    L ++  YPF+KRF   PQ  LGI F  G+ + + A
Sbjct: 102 AALSAAAFVLVLPLNTLTILLSVPALLLAGSYPFTKRFFAIPQAYLGIAFGFGIPMAFAA 161

Query: 179 LHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYG 238
           +  +     + + +  IFW V +DT YA  D+ DD  IG+ ++A  F     L + + Y 
Sbjct: 162 VTGTVPATGWLMLLANIFWAVAYDTEYAMVDRPDDLKIGIKTSAITFGRHDVLAVMLCYA 221

Query: 239 IFVLCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILIL 298
              +   V   L  + F  + GL++A  +       +       C   F     VG  I 
Sbjct: 222 ATFVLLTVVGALAGLGFAWYAGLVVACAIAGYHYTLIRARDRADCFKAFRHNNWVGGAIF 281

Query: 299 ICLIISLFL 307
             L I L L
Sbjct: 282 AGLFIDLLL 290


>gi|253686912|ref|YP_003016102.1| 4-hydroxybenzoate polyprenyl transferase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|259550851|sp|C6DKC9|UBIA_PECCP RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|251753490|gb|ACT11566.1| 4-hydroxybenzoate polyprenyl transferase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 287

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 89/284 (31%), Positives = 130/284 (45%), Gaps = 9/284 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  LA          G +   W LF+++ G  + R A 
Sbjct: 13  YCRLMRIDKPIGSLLLLWPTLWALWLAG---------GGAPAPWTLFVFVAGVFLMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D   D  V RT SRPLPSG+ +   A V  V+  L++F L+L  N   I +  
Sbjct: 64  CVINDYADRHFDGHVKRTASRPLPSGEVSEQSAKVLFVVLVLLAFGLVLTLNTMTIWLSV 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++ +YPF KR    PQ VLG  F   + + + A+  S     + + +  I W V +
Sbjct: 124 AGLGLAWVYPFMKRVSHLPQFVLGAAFGWSIPMAYAAVSESLPATCWMMFLAYICWTVAY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF     L + +L    +   ++   +  +    +I L
Sbjct: 184 DTQYAMVDRDDDLKIGVKSTAILFGRFDNLIIGLLQFSMLALLLILGTMTGLGMPYYISL 243

Query: 262 LIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
           L+A  + I + I         C   FH+    G+ I I ++  L
Sbjct: 244 LVAGGMFIYQQILTAGRERDACFKAFHNNKYAGMAIFIGVLFGL 287


>gi|190345176|gb|EDK37018.2| hypothetical protein PGUG_01116 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 380

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 115/217 (52%), Gaps = 5/217 (2%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L +LP  W   +AAY +  A VL   T    + ++ +GA+V RGA
Sbjct: 89  PYAELMRLEKPVGTLLLLLPSFWGITMAAYGIG-APVL---TTLKVVSLFSIGALVMRGA 144

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL+D D+D++V RT  RP+ SG+ +  QA+ F  +Q      +LL        +G
Sbjct: 145 GCTINDLLDRDLDNKVARTMERPIASGRVSVPQAITFLGVQCFAGLGVLLSLPFECFYLG 204

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFS-WPAFFLCIGTIFWVV 199
              L     YP  KRF   PQ +L I F+ G  +G+ A+ A  + + A  L I    W +
Sbjct: 205 ALSLPFVAAYPLFKRFTYYPQAMLSICFSWGCLLGFPAVGAPLNLFVAVPLFISNFLWCM 264

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFIL 236
            +DT+YAHQDKK D   G+ STA  +  +++ ++ +L
Sbjct: 265 IYDTIYAHQDKKFDISAGIKSTALKWGDKSRPYMNVL 301


>gi|330447174|ref|ZP_08310824.1| 4-hydroxybenzoate polyprenyl transferase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328491365|dbj|GAA05321.1| 4-hydroxybenzoate polyprenyl transferase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 283

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 89/282 (31%), Positives = 137/282 (48%), Gaps = 11/282 (3%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           LAR+    G  L + P LW+  LAA  +    VL          ++++G I  R A C  
Sbjct: 10  LARFDRPIGSLLLLWPTLWALFLAADGMPNINVL---------VVFVLGVIFMRAAGCVI 60

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND  D + D  V RT+ RP+PSG+ +  +AL    L  L+SF+L+L  N   I +    L
Sbjct: 61  NDFADRNFDGHVKRTKHRPMPSGKVSEREALGLFFLLVLVSFLLVLTMNKLTIMLSVVGL 120

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            ++  YPF KR+   PQ+VLG+ F   + + + A   + S  A+ L    I W + +DT 
Sbjct: 121 LLASSYPFMKRYTHLPQLVLGVAFGWSIPMAYAAQAGNLSVSAWLLFAANILWTIAYDTQ 180

Query: 205 YAHQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFMVAFCLLTVNFFAWIGLLI 263
           YA  D+ DD  +G+ STA LF    KL + +L      L   V   L     F W  LL+
Sbjct: 181 YAMVDRDDDLKVGIKSTAILFGRFDKLIIGVLQLTTLGLLIAVGMVLQLGQVFYWC-LLL 239

Query: 264 ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
           A  L + + + L     + C   F +    G++I + +++S+
Sbjct: 240 ASCLFVYQQMLLKERQRESCFRAFLNNNYFGMIICLGIVLSV 281


>gi|219870994|ref|YP_002475369.1| 4-hydroxybenzoate octaprenyltransferase [Haemophilus parasuis
           SH0165]
 gi|219691198|gb|ACL32421.1| 4-hydroxybenzoate octaprenyltransferase [Haemophilus parasuis
           SH0165]
          Length = 290

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 95/301 (31%), Positives = 141/301 (46%), Gaps = 41/301 (13%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L R     G  L + P LW+    A  +    +L          I+++G IV R A 
Sbjct: 13  YMQLMRLDKPIGTFLLLWPTLWALFAVADGVPPLPIL---------IIFVLGVIVMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLISFVLLLQFNPFVICVG 140
           C  ND  D  ID  V RT  RPL +G+ T  +A ++FA L F I+F+L+LQ N + + + 
Sbjct: 64  CVINDYADRYIDGNVKRTSQRPLATGRATAKEAKILFATLIF-IAFLLVLQLNLYTLGLS 122

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              + ++ +YPF KR+   PQ VLG+ F   + + +GA+  +     + L    + W V 
Sbjct: 123 VIAVALATVYPFMKRYTHLPQFVLGMAFGWSIPMAYGAVSETLPLKCWLLFFANLAWTVA 182

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFS-YQTKLWLFILYGIFVLCFMVAFCLLTV------ 253
           +DT YA  D+ DD  IGV STA LF+ Y  K        I  L    A  LLT+      
Sbjct: 183 YDTQYAMVDRDDDLRIGVKSTAILFAQYDNK--------IIALLQATALVLLTIFGKISH 234

Query: 254 ---NFFAWIGLLIALF-----LTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
               +F  +GL   LF     LT +R         + C   F +   VG+ I I ++I +
Sbjct: 235 YSTAYFIALGLTATLFIYQCKLTKQR-------EREACFKAFLNNHYVGMGIFISILIGI 287

Query: 306 F 306
           +
Sbjct: 288 Y 288


>gi|167622484|ref|YP_001672778.1| 4-hydroxybenzoate octaprenyltransferase [Shewanella halifaxensis
           HAW-EB4]
 gi|189037003|sp|B0TRE7|UBIA_SHEHH RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|167352506|gb|ABZ75119.1| 4-hydroxybenzoate polyprenyl transferase [Shewanella halifaxensis
           HAW-EB4]
          Length = 287

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 116/226 (51%), Gaps = 9/226 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ LAR     G  L + PCL +   AA  L    V           I+++G +V R   
Sbjct: 10  YMRLARMDRPIGTLLLLWPCLMALTFAAGGLPDLKVF---------IIFVIGVVVMRACG 60

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D D+DS V RT++RPL SG+ +  +AL+   +  L +F L+L  NP V+ +  
Sbjct: 61  CIINDYADRDLDSHVERTKARPLASGEISSKEALLLFGVMGLFAFSLVLMLNPLVVQLSV 120

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + ++++YPF+KR+   PQ+ LG  ++  + + + A   +    A++L      W V +
Sbjct: 121 VGIILTIIYPFTKRYTNMPQMFLGTVWSWSIPMAYAAQTGTVPIEAWWLFAANWCWTVAY 180

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA 247
           DT+YA  D+ DD  +G+ STA LF    +  +       + CF++A
Sbjct: 181 DTMYAMVDRDDDLKVGIKSTAILFGRYDRQIIAAFQLAALSCFIIA 226


>gi|396375|gb|AAC43134.1| 4-hydroxybenzoate-octaprenyl transferase [Escherichia coli str.
           K-12 substr. MG1655]
          Length = 290

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 124/247 (50%), Gaps = 12/247 (4%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
            W L +++ G  + R A C  ND  D   D  V RT +RPLPSG  T  +A    V+  L
Sbjct: 46  LWILAVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVL 105

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           ISF+L+   N   I +  A L ++ +YPF KR+   PQVVLG  F   + + + A+  S 
Sbjct: 106 ISFLLVXTLNTMTILLSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESV 165

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
               + + +  I W V +DT YA  D+ DD  IG+ STA LF    KL + IL  I VL 
Sbjct: 166 PLSCWLMFLANILWAVAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQ-IGVLA 224

Query: 244 FMVAFCLLTVNFFAW-----IGLLIALFLTIKRIIALDISCSKQCC-SFFHSAGVVGILI 297
            M     L  N   W     I +  ALF+  +++IA   +  ++ C   F +   VG+++
Sbjct: 225 LMAIIGEL--NGLGWGYYWSILVAGALFVYQQKLIA---NREREACFKAFMNNNYVGLVL 279

Query: 298 LICLIIS 304
            + L +S
Sbjct: 280 FLGLAMS 286


>gi|296100666|ref|YP_003610812.1| 4-hydroxybenzoate octaprenyltransferase [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295055125|gb|ADF59863.1| 4-hydroxybenzoate octaprenyltransferase [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 289

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 143/288 (49%), Gaps = 15/288 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  +A       GV       W L +++ G  + R A 
Sbjct: 13  YHRLMRTDKPIGALLLLWPTLWALWVAT-----PGV----PPLWILGVFVAGVWLMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D   D  V RT +RPLPSGQ T  +A V  ++  L+SF+L+L  N   I +  
Sbjct: 64  CVVNDYADRKFDGHVKRTANRPLPSGQVTEKEARVLFIVLVLLSFLLVLTLNTMTILLSV 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++ +YPF KR+   PQVVLG  F   + + + A+  S     + + +  I W V +
Sbjct: 124 AALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWAVAY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLT-VNFFAWIG 260
           DT YA  D+ DD  IG+ STA LF    KL + IL  + VL  MVA   L  +N+  +  
Sbjct: 184 DTQYAMVDRDDDLKIGIKSTAILFGRHDKLIIGILQ-VAVLALMVAIGRLNGLNWEFYWS 242

Query: 261 LLIA--LFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
           +L+A  LF   +++IA        C   F +   VG+++ + L +S F
Sbjct: 243 VLVAGLLFAYQQKLIA--KRERDACFKAFMNNNYVGLVLFLGLAMSYF 288


>gi|183600455|ref|ZP_02961948.1| hypothetical protein PROSTU_04031 [Providencia stuartii ATCC 25827]
 gi|188019939|gb|EDU57979.1| hypothetical protein PROSTU_04031 [Providencia stuartii ATCC 25827]
          Length = 288

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 86/283 (30%), Positives = 130/283 (45%), Gaps = 9/283 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P  W+  +AA  +    +L          ++  G  + R A 
Sbjct: 13  YSRLMRIDRPIGSLLLLWPTYWALWIAAQSIPSLHIL---------IVFTAGVFLMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D   D  V RT+ RPLPSG  T  +A +       +SF+L+L  N   I +  
Sbjct: 64  CVINDFADRHFDGHVERTKHRPLPSGDVTEKEAKILFASLVGLSFLLVLTLNSMTIWLSV 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++ +YPF KR    PQVVLG  F   + +G+ A+  S     + L +  I W V +
Sbjct: 124 AGLALAWIYPFVKRVSHLPQVVLGAAFGWSIPMGFSAVSESLPLVCWVLFLVNILWSVIY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF    KL + IL  + ++  ++   L  +    +I L
Sbjct: 184 DTQYAMVDRNDDLKIGVKSTAILFGQYDKLIIGILQIVMIVLLVLVGSLADLGAVYYIAL 243

Query: 262 LIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            ++  L I +   +       C   F +   VG+++ I + +S
Sbjct: 244 SLSALLFIYQQKLMVDRERAPCFKAFLNNNYVGLILFIGIFLS 286


>gi|171058296|ref|YP_001790645.1| 4-hydroxybenzoate polyprenyl transferase [Leptothrix cholodnii
           SP-6]
 gi|170775741|gb|ACB33880.1| 4-hydroxybenzoate polyprenyl transferase [Leptothrix cholodnii
           SP-6]
          Length = 288

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 115/221 (52%), Gaps = 9/221 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L RW    GW L     LW T LAA  +   G  GW      L ++ +G I+ R A 
Sbjct: 11  YLNLIRWDRPAGWLL----LLWPT-LAALWIAAGGFPGWH----LLIVFTLGTILMRSAG 61

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND+ D D D  V RT +RP+ SG     +AL+   +  L +F+L+L  N   I   F
Sbjct: 62  CCINDVADRDFDRHVKRTANRPVTSGAIGVREALLVGAVLALAAFLLVLTTNAPTITWSF 121

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L +++ YP++KR +  PQ VLG+ F+ G+ + + A+ +     A  L IG +FWV+ +
Sbjct: 122 AALAVAMAYPYAKRHVSMPQAVLGVAFSFGIPMAFAAVQSQVPPVAIGLLIGNLFWVLAY 181

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVL 242
           DT YA  D+ DD  IG+ ++A        + +   Y  FVL
Sbjct: 182 DTEYAMVDRDDDLRIGIKTSAITLGAFDVIGVMAFYAAFVL 222


>gi|257061492|ref|YP_003139380.1| 4-hydroxybenzoate polyprenyltransferase [Cyanothece sp. PCC 8802]
 gi|256591658|gb|ACV02545.1| 4-hydroxybenzoate polyprenyl transferase [Cyanothece sp. PCC 8802]
          Length = 292

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/247 (31%), Positives = 121/247 (48%), Gaps = 19/247 (7%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAY---PLRRAGVLGWSTIFWYLFIYIVGAIVTRG 79
           + L RW    G  + ++P LW+  LAA    PL   GV+            I+G++ T  
Sbjct: 17  IRLLRWDKPAGRLILMIPALWAVFLAAKGTPPLPLVGVI------------ILGSLATSA 64

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICV 139
           A C  NDL D +ID QV RTR+RPL     +    +V AV+    + +L    N     +
Sbjct: 65  AGCVINDLWDREIDPQVERTRTRPLAEKSLSIKVGIVIAVIALGCAAILAFYLNSLSFWL 124

Query: 140 GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVV 199
             A + + + YP +KR    PQ+VL + +   V + W A+ A      + L   T+FW +
Sbjct: 125 CVAAVPVIVCYPLAKRVFPIPQLVLSLAWGFAVLISWTAVTAKLELSTWILWAATVFWTL 184

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFS--YQTKLWLFILYGIFVLCFMVAFCLLTVNFFA 257
            FDTVYA  D++DD  IG+NS+A  F       + LF +  + +L ++    +L +N + 
Sbjct: 185 GFDTVYAMSDREDDRKIGINSSALFFGDYAAEAVGLFFVLAVGLLAYLGE--ILEMNLWF 242

Query: 258 WIGLLIA 264
           W  L IA
Sbjct: 243 WGSLGIA 249


>gi|194432215|ref|ZP_03064503.1| 4-hydroxybenzoate polyprenyl transferase [Shigella dysenteriae
           1012]
 gi|194419418|gb|EDX35499.1| 4-hydroxybenzoate polyprenyl transferase [Shigella dysenteriae
           1012]
 gi|320179036|gb|EFW53995.1| 4-hydroxybenzoate polyprenyltransferase [Shigella boydii ATCC 9905]
 gi|332084231|gb|EGI89434.1| 4-hydroxybenzoate polyprenyl transferase [Shigella dysenteriae
           155-74]
          Length = 290

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 125/245 (51%), Gaps = 8/245 (3%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
            W L +++ G  + R A C  ND  D   D  V RT +RPLPSG  T  +A    V+  L
Sbjct: 46  LWILAVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVL 105

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           ISF+L+L  N   I +  A L ++ +YPF KR+   PQVVLG  F   + + + A+  S 
Sbjct: 106 ISFLLVLTLNTMTILLSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESV 165

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
               + + +  I W V +DT YA  D+ DD  IG+ STA LF    KL + IL  I VL 
Sbjct: 166 PLSCWLMFLANILWAVAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQ-IGVLA 224

Query: 244 FMVAFCLLTV---NFFAWIGLLIALFLTIKRIIALDISCSKQCC-SFFHSAGVVGILILI 299
            M     L      ++  I +  ALF+  +++IA   +  ++ C   F +   VG+++ +
Sbjct: 225 LMAIIGELHGLGWGYYWSILVAGALFVYQQKLIA---NREREACFKAFMNNNYVGLVLFL 281

Query: 300 CLIIS 304
            L +S
Sbjct: 282 GLAMS 286


>gi|119475183|ref|ZP_01615536.1| 4-hydroxybenzoate octaprenyltransferase [marine gamma
           proteobacterium HTCC2143]
 gi|119451386|gb|EAW32619.1| 4-hydroxybenzoate octaprenyltransferase [marine gamma
           proteobacterium HTCC2143]
          Length = 287

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 71/217 (32%), Positives = 113/217 (52%), Gaps = 9/217 (4%)

Query: 15  MGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGA 74
           + + I  Y+ L R+    G +L + P LW+  +AA           +  F  L I+ +G 
Sbjct: 5   VAAKIPYYLALIRFDRPIGTYLLLWPTLWALWIAAEG---------TPDFKLLVIFSLGT 55

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
            + R A C  ND  D  ID QV RT +RP+ +G+ +   AL+FA +  +++F+L+L  N 
Sbjct: 56  FLMRSAGCAINDYADRHIDGQVKRTSNRPIVTGKISPRSALLFAAVLCILAFLLVLSTNQ 115

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT 194
             + + FA   ++  YPF KR+   PQ+VLG  FA  + + + A   +     + + +  
Sbjct: 116 KTVLLSFAAAALAACYPFMKRYTHLPQIVLGAAFAWSIPMAFAAQQNAMPALLWLIYLAV 175

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
           + W   +DT YA  D+ DD +IGV STA LF  Q +L
Sbjct: 176 LLWTTAYDTFYAMVDRDDDIIIGVKSTAILFGKQDRL 212


>gi|90581418|ref|ZP_01237213.1| putative 4-hydroxybenzoate octaprenyltransferase [Vibrio angustum
           S14]
 gi|90437395|gb|EAS62591.1| putative 4-hydroxybenzoate octaprenyltransferase [Vibrio angustum
           S14]
          Length = 286

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 84/281 (29%), Positives = 137/281 (48%), Gaps = 9/281 (3%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           LAR+    G  L + P LW+  LAA  +    VL          ++++G I  R A C  
Sbjct: 13  LARFDRPIGSLLLLWPTLWALFLAADGMPNINVL---------IVFVLGVIFMRAAGCVI 63

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND  D + D  V RT+ RP+PSG+ +  +AL    L  L+SF+L+L  N   I +    +
Sbjct: 64  NDFADRNFDGHVKRTKDRPMPSGKVSEREALGLFFLLVLVSFLLVLTMNSLTIMLSVVGV 123

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            ++  YPF KR+   PQ+VLG+ F   + + + A     S  A+ L    I W + +DT 
Sbjct: 124 LLAACYPFMKRYTHLPQLVLGVAFGWSIPMAYAAQAGDLSLSAWLLFTANILWTIAYDTQ 183

Query: 205 YAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIA 264
           YA  D+ DD  +G+ STA LF    KL + +L    +   +    +L +    +  LLIA
Sbjct: 184 YAMVDRDDDLKVGIKSTAILFGRFDKLIIGLLQLATLSLLIAVGMVLQLGQVYYWSLLIA 243

Query: 265 LFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
             L + + + L     + C   F +    G+++ + +++S+
Sbjct: 244 SGLFVYQQMLLKERLRESCFRAFLNNNYFGMIVCVGIVLSV 284


>gi|329897887|ref|ZP_08272237.1| 4-hydroxybenzoate polyprenyltransferase [gamma proteobacterium
           IMCC3088]
 gi|328921013|gb|EGG28432.1| 4-hydroxybenzoate polyprenyltransferase [gamma proteobacterium
           IMCC3088]
          Length = 289

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 85/293 (29%), Positives = 135/293 (46%), Gaps = 9/293 (3%)

Query: 15  MGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGA 74
           M S +  +  L R     G  L + P  W+  LA+      G   W      L I+  G 
Sbjct: 1   MQSKLLGFAQLMRIDKPVGTLLLLWPTYWALWLAS-----GGFPEWE----LLLIFTAGV 51

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
            + R A C  ND  D   D  V RT SRPL +G  T  +A+        +SF L+L  NP
Sbjct: 52  FLMRAAGCVINDFADRGWDGGVKRTASRPLVTGAVTPKEAITLFFALITLSFFLVLLTNP 111

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT 194
           F I +  A   I+ +YPF KR    PQ+VLG  F+ G+ + + A   +     + + +  
Sbjct: 112 FTILLSLAAAGIAAIYPFVKRVSHLPQIVLGAAFSFGIPMAFSATQNALPPALWLIFLAN 171

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
           + W + +DT+YA  D+ DD ++G+ STA LF    +L + IL  +    +++       +
Sbjct: 172 LLWTMAYDTLYAMVDRDDDLIVGIKSTAILFGQADRLIVGILQAMTFALWLLMAWQFQRH 231

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
             A+IG+++A    I +   +       C   F    VVG+++   L + L+L
Sbjct: 232 EPAYIGIIVASLGFIWQQWRIKDRARMACFRAFKDNIVVGLIVFAGLAVDLYL 284


>gi|254797143|ref|YP_003081981.1| 4-hydroxybenzoate octaprenyltransferase [Neorickettsia risticii
           str. Illinois]
 gi|254590381|gb|ACT69743.1| 4-hydroxybenzoate octaprenyltransferase [Neorickettsia risticii
           str. Illinois]
          Length = 280

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 87/288 (30%), Positives = 144/288 (50%), Gaps = 16/288 (5%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFI--YIVGAIV 76
           I  Y  L R+ S  G  L   P L+   L          LG S+ + +L+I  +++GA +
Sbjct: 3   IKKYASLIRFQSLGGMWLCFFPALFVVAL----------LG-SSFYSFLWIPFFLLGAFL 51

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  ND+ D +ID +V RT SRP+ SG+ +  +A++  ++  +++ VLL       
Sbjct: 52  VRSAGCIANDIADRNIDGKVKRTASRPIASGEVSVTEAVLLFLILLILATVLLAFLPLEA 111

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
             +G   +   ++YPFSKR+   PQ++L + F  G       +  S    A F+ +   F
Sbjct: 112 TALGAFTIVGVVVYPFSKRYFAYPQLLLAVIFNVGALFASIVVVNSIHASALFIYLACFF 171

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV-AFCLLTVNF 255
           W +Y+DT+Y HQDK+ D  +GV+S + L  + +K WL   Y    L F+  +  L  +N 
Sbjct: 172 WTLYYDTIYGHQDKRYDAALGVHSLS-LGKFGSKEWL-KKYARLALSFLAFSAVLPGLNL 229

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLII 303
             +IGL    F+  K   ++++   K C   F     VG+LI   +++
Sbjct: 230 LYYIGLAALFFMEEKFTESINLDDPKNCGIAFKRMNFVGVLIFFIILL 277


>gi|89076083|ref|ZP_01162443.1| putative 4-hydroxybenzoate octaprenyltransferase [Photobacterium
           sp. SKA34]
 gi|89048235|gb|EAR53817.1| putative 4-hydroxybenzoate octaprenyltransferase [Photobacterium
           sp. SKA34]
          Length = 286

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 84/281 (29%), Positives = 137/281 (48%), Gaps = 9/281 (3%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           LAR+    G  L + P LW+  LAA  +    VL          ++++G I  R A C  
Sbjct: 13  LARFDRPIGSLLLLWPTLWALFLAADGMPNINVL---------IVFVLGVIFMRAAGCVI 63

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND  D + D  V RT+ RP+PSG+ +  +AL    L  L+SF+L+L  N   I +    L
Sbjct: 64  NDFADRNFDGHVKRTKDRPMPSGKVSEREALGLFFLLVLVSFLLVLTMNSLTIMLSVVGL 123

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            ++  YPF KR+   PQ+VLG+ F   + + + A     S  A+ L    I W + +DT 
Sbjct: 124 LLAACYPFMKRYTHLPQLVLGVAFGWSIPMAYAAQAGDLSLSAWLLFTANILWTIAYDTQ 183

Query: 205 YAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIA 264
           YA  D+ DD  +G+ STA LF    KL + +L    +   +    +L +    +  LL+A
Sbjct: 184 YAMVDRDDDLKVGIKSTAILFGRFDKLIIGLLQLATLSLLIAVGMVLQLGQVYYWSLLLA 243

Query: 265 LFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
             L + + + L     + C   F +    G+++ + +++S+
Sbjct: 244 SGLFVYQQMLLKERLRESCFRAFLNNNYFGMIVCLGIVLSV 284


>gi|330720571|gb|EGG98844.1| 4-hydroxybenzoate polyprenyltransferase [gamma proteobacterium
           IMCC2047]
          Length = 297

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 67/218 (30%), Positives = 105/218 (48%), Gaps = 9/218 (4%)

Query: 13  CIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIV 72
             + + ++ Y  L R     G +L + P LW+  +AA       +L          I++ 
Sbjct: 9   TTLSNQLSDYALLMRLEKPIGIYLLLWPTLWALWIAASGFPDPKIL---------MIFVA 59

Query: 73  GAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQF 132
           G I+ R A C  ND  D  ID  V RT+ RP+ SG+ +  +AL       LI+F+L+L  
Sbjct: 60  GVILMRSAGCVINDFADRKIDRHVARTKDRPITSGRVSSTEALTLFATLTLIAFLLVLMT 119

Query: 133 NPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCI 192
           N   I +      ++  YPF KR+   PQ+VLG+ F   + + + A        A+ +  
Sbjct: 120 NWLTIGLSVIAALLATSYPFMKRYTYLPQLVLGMAFGMSIPMAFAAQTGEVPAIAWLIYT 179

Query: 193 GTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
             + W + +DT+YA  D++DD  IGV STA LF    +
Sbjct: 180 ANVLWTLTYDTMYAITDREDDLKIGVKSTAILFGEHDR 217


>gi|326484844|gb|EGE08854.1| para-hydroxybenzoate-polyprenyltransferase Coq2 [Trichophyton
           equinum CBS 127.97]
          Length = 395

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 111/211 (52%), Gaps = 14/211 (6%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R    TG +    PCL+ST+LAA PL          + W+  ++  GA+V RGA
Sbjct: 86  PYAELIRLDKPTGTYYLYFPCLFSTLLAA-PLAMPMATPLE-VAWFSGLFFAGALVMRGA 143

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL D ++D  V RT+ RP+     T   A++F   Q L    +LLQF PF  C  
Sbjct: 144 GCTINDLWDRNLDPHVERTKFRPIARRAITPKHAIIFTGTQLLSGLAILLQF-PFE-CFW 201

Query: 141 FA---LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHAS-FSWPAFFLCIGTIF 196
           +A   LLF++  YP +KR    PQ +LG+ F+ G  +G+ AL     S P+      +++
Sbjct: 202 YATPSLLFVA-AYPLAKRVTNYPQAMLGLTFSWGAVMGFPALGVEVLSDPSILAACASLY 260

Query: 197 -----WVVYFDTVYAHQDKKDDELIGVNSTA 222
                W + +DT+YAH D KDD   G+ S A
Sbjct: 261 ASNVAWTILYDTIYAHMDVKDDAKAGIKSIA 291


>gi|326474713|gb|EGD98722.1| monothiol glutaredoxin [Trichophyton tonsurans CBS 112818]
          Length = 395

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 111/211 (52%), Gaps = 14/211 (6%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R    TG +    PCL+ST+LAA PL          + W+  ++  GA+V RGA
Sbjct: 86  PYAELIRLDKPTGTYYLYFPCLFSTLLAA-PLAMPMATPLE-VAWFSGLFFAGALVMRGA 143

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL D ++D  V RT+ RP+     T   A++F   Q L    +LLQF PF  C  
Sbjct: 144 GCTINDLWDRNLDPHVERTKFRPIARRAITPKHAIIFTGTQLLSGLAILLQF-PFE-CFW 201

Query: 141 FA---LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHAS-FSWPAFFLCIGTIF 196
           +A   LLF++  YP +KR    PQ +LG+ F+ G  +G+ AL     S P+      +++
Sbjct: 202 YATPSLLFVA-AYPLAKRVTNYPQAMLGLTFSWGAVMGFPALGVEVLSDPSILAACASLY 260

Query: 197 -----WVVYFDTVYAHQDKKDDELIGVNSTA 222
                W + +DT+YAH D KDD   G+ S A
Sbjct: 261 ASNVAWTILYDTIYAHMDVKDDAKAGIKSIA 291


>gi|126659555|ref|ZP_01730687.1| 4-hydroxybenzoate octaprenyltransferase [Cyanothece sp. CCY0110]
 gi|126619194|gb|EAZ89931.1| 4-hydroxybenzoate octaprenyltransferase [Cyanothece sp. CCY0110]
          Length = 295

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 90/293 (30%), Positives = 137/293 (46%), Gaps = 21/293 (7%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAY---PLRRAGVLGWSTIFWYLFIYIVGAIVTRG 79
           + L RW    G  + ++P LW+  LAA    PL   GV+            I+G + T  
Sbjct: 17  IRLLRWDKPAGRLILMIPALWAIFLAARGIPPLPLVGVI------------ILGTLATSA 64

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFN--PFVI 137
           A C  NDL D DIDSQV RT++RPL     +    ++ A +  + + +L    N   F++
Sbjct: 65  AGCVINDLWDRDIDSQVERTQTRPLAERSLSIKVGILIAFIALICAAILAFYLNTLSFIL 124

Query: 138 CVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFW 197
           CV    L +   YP +KR    PQ+VL + +   V + W A+        + L   T+FW
Sbjct: 125 CVAAVPLIVC--YPLAKRVFPIPQLVLSLAWGFAVLISWTAVTGQLENHTWVLWGITVFW 182

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFA 257
            + FDTVYA  D++DD+ IGVNS+A  F       + I + I    +      + +N   
Sbjct: 183 TLGFDTVYAMSDREDDKKIGVNSSALFFGKYAGEAVGIFFAITAGLWAYLGVTMHLNLGF 242

Query: 258 WIGLLIALFLTIKRIIALDISCSKQCC--SFFHSAGVVGILILICLIISLFLD 308
           WI  +IAL   + + I L      Q      F    V+G ++L  +I+S+ L 
Sbjct: 243 WITWVIALVGWMIQYIRLSSPEIPQQTYGQVFRQNVVIGFIVLGGIIVSITLK 295


>gi|170589982|ref|XP_001899752.1| 4-hydroxybenzoate polyprenyl transferase family protein [Brugia
           malayi]
 gi|158592878|gb|EDP31474.1| 4-hydroxybenzoate polyprenyl transferase family protein [Brugia
           malayi]
          Length = 260

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/191 (36%), Positives = 100/191 (52%), Gaps = 7/191 (3%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           I PY+ L R    TG+ L   PC WS  L+A P       G       L ++  G+I+ R
Sbjct: 48  IQPYLKLMRIDKPTGFWLLYWPCTWSIALSATP-------GSLPDLKMLALFGAGSILMR 100

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
            A C  ND+ D + D  V RT+SRPL SG+ +  QAL    +    S  +LLQF+ F + 
Sbjct: 101 SAGCIVNDIFDKNYDRMVERTQSRPLASGELSNRQALSVLAVLLSGSLAILLQFSWFSVA 160

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           VG + LF+ ++YP +KR+   PQ VLG+    GVF+ W  L  +       L   T+ + 
Sbjct: 161 VGASSLFLVVVYPLAKRYTYWPQFVLGLTSNWGVFIAWSHLCPNTLLTVIPLYTATVLYT 220

Query: 199 VYFDTVYAHQD 209
             +DT+Y+HQD
Sbjct: 221 ATYDTIYSHQD 231


>gi|241664093|ref|YP_002982453.1| 4-hydroxybenzoate octaprenyltransferase [Ralstonia pickettii 12D]
 gi|240866120|gb|ACS63781.1| 4-hydroxybenzoate polyprenyl transferase [Ralstonia pickettii 12D]
          Length = 291

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 100/201 (49%)

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           I+ VG  + R A C  ND  D D D  V RT+ RP+ +G    ++AL  A +  LI+F L
Sbjct: 52  IFTVGTFLMRSAGCAVNDWADRDFDKHVKRTKERPITAGLIAPWEALAVAAVLSLIAFTL 111

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           +L  N     +  A + I+  YPF KRF   PQ  LGI F  G+ + + A+       A+
Sbjct: 112 ILPLNALTKWMSVAAIVIAGTYPFFKRFFAIPQAYLGIAFGFGIPMAYAAVQDQVPALAW 171

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAF 248
            +  G +FW V +DT YA  D+ DD LIG+ ++A  F       + + Y  F      A 
Sbjct: 172 LMLAGNVFWAVAYDTAYAMVDRDDDLLIGIKTSAITFGRYDVAAIMLCYVGFFGIMAWAG 231

Query: 249 CLLTVNFFAWIGLLIALFLTI 269
            L+ +    WIG   A+ L++
Sbjct: 232 HLMALGVAYWIGFAAAVALSL 252


>gi|87121078|ref|ZP_01076969.1| 4-hydroxybenzoate polyprenyltransferase [Marinomonas sp. MED121]
 gi|86163570|gb|EAQ64844.1| 4-hydroxybenzoate polyprenyltransferase [Marinomonas sp. MED121]
          Length = 285

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 98/174 (56%), Gaps = 1/174 (0%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L I+I G    R A C  ND  D  +D  V RT++RPLPSG+ +  +AL F     +ISF
Sbjct: 43  LLIFIAGVFSMRSAGCVINDYADRKVDGSVERTKNRPLPSGRVSEKEALCFFAFLCVISF 102

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFS-W 185
           +L+L  +   I + F  LF++ LYPF KRF   PQ+ LG+ F+  + + + A   S S  
Sbjct: 103 ILVLFTDLKTILLSFVGLFLAALYPFMKRFTHLPQLFLGLAFSWAIPMAYVAQGGSLSDI 162

Query: 186 PAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGI 239
             + L +  +FW + +DT YA  D+ DD  IG+ STA LF+    L + +L G+
Sbjct: 163 QLWMLFLANVFWTIAYDTYYAMVDRNDDLTIGIKSTAILFAQYDLLIIVLLQGL 216


>gi|239996987|ref|ZP_04717511.1| 4-hydroxybenzoate octaprenyltransferase [Alteromonas macleodii ATCC
           27126]
          Length = 285

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 81/286 (28%), Positives = 132/286 (46%), Gaps = 9/286 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G +L + P LW+ ++AA  L   G+           I++ G +V R A 
Sbjct: 8   YARLMRLDKPVGIYLLLWPTLWALLMAAQGLPPLGIT---------LIFVAGVVVMRSAG 58

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D  V RT  RPL +G+ +  QAL        ++FVL+L  N   I +  
Sbjct: 59  CVINDYADRKVDGSVKRTAQRPLATGEVSAKQALQLFAALIALAFVLVLFLNWQTIALSV 118

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++  YPF KR+   PQVVLG  F   + + + A+  +     ++L I  + W V +
Sbjct: 119 VALLLAASYPFMKRYTNLPQVVLGAAFGWAIPMAFMAVIETVPAYGWWLFIANLLWTVAY 178

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT+YA  D+ DD  IG+ STA LF     L + +L    +       C +   +  +I +
Sbjct: 179 DTMYAMVDRDDDLQIGIKSTAILFGKNDVLIVMLLQAAALAILWCIGCAINATWPYYIAV 238

Query: 262 LIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
           L +  L +++   +     + C + F     +G+ I +   +  +L
Sbjct: 239 LFSALLCVRQYQLIKRRQREGCFTAFIENHYIGLAITLGTALHFYL 284


>gi|86610275|ref|YP_479037.1| 4-hydroxybenzoate polyprenyltransferase [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86558817|gb|ABD03774.1| 4-hydroxybenzoate polyprenyl transferase [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 300

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 109/215 (50%), Gaps = 21/215 (9%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLF-IYIVGAIVTRGAACT 83
           L RWH   G  + ++P LW   LA          G  T  W L  I I+G++   GA C 
Sbjct: 18  LLRWHKPAGRLILMIPALWGAFLA----------GRGTPPWPLVGIIILGSLAASGAGCV 67

Query: 84  WNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP--FVICVGF 141
            NDL D D+D  V RTR RPL S + T    ++ AV+    +  L L  NP  F +CV  
Sbjct: 68  INDLWDRDLDPLVERTRHRPLASRELTVGVGILMAVVSLACAAGLALFLNPVSFALCV-- 125

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFS----WPAFF--LCIGTI 195
           A + + LLYP +KR    PQ+VL + +   V + W A+    +    W      L + T+
Sbjct: 126 AAVPVILLYPGAKRVFPVPQLVLALAWGFAVLISWTAVSGQDANTPLWEEGLGWLWLATV 185

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
            W + FDTVYA  D++DDE  G++S+AR F  +T 
Sbjct: 186 LWTLGFDTVYALADREDDERAGIHSSARFFGQRTP 220


>gi|253991403|ref|YP_003042759.1| 4-hydroxybenzoate octaprenyltransferase [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253782853|emb|CAQ86018.1| 4-hydroxybenzoate octaprenyltransferase [Photorhabdus asymbiotica]
          Length = 288

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 101/210 (48%), Gaps = 9/210 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P  W+  +A   +    +L          ++  G  + R A 
Sbjct: 13  YCRLVRIDRPIGSLLLLWPTFWALWIAGKGIPNMHIL---------LVFTAGVFLMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D   D  V RT++RPLPSG  +  ++ +  V+  LISF L+L  N   I + F
Sbjct: 64  CVINDFADRKFDGYVERTKTRPLPSGAISEKESKILFVVLVLISFGLVLTLNKMTIYLSF 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++  YPF KRF   PQ VLG  +   + +G+ A+  S     + L +  I W V +
Sbjct: 124 AGLALAWFYPFVKRFSNLPQFVLGAAYGWSIPMGFAAVSESLPLECWLLFLTNILWSVVY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
           DT YA  D+ DD  IG+ STA LF    KL
Sbjct: 184 DTQYAMVDRNDDLKIGIKSTAVLFGRFDKL 213


>gi|238760280|ref|ZP_04621423.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia aldovae ATCC
           35236]
 gi|238701482|gb|EEP94056.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia aldovae ATCC
           35236]
          Length = 273

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 137/280 (48%), Gaps = 13/280 (4%)

Query: 27  RWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWND 86
           R     G  L + P LW+  LA   +    +L          ++++G +  R A C  ND
Sbjct: 2   RLDKPIGSLLLLWPTLWALWLAGQGIPDTKIL---------IVFVLGVLFMRAAGCVVND 52

Query: 87  LVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFI 146
             D  ID  V RT SRPLPSG  +  ++ +  V+  L+SF L+L  N   I +  A L +
Sbjct: 53  YADRHIDGFVKRTASRPLPSGIISERESKILFVVLVLLSFGLVLTLNSMTIWLSLAALAL 112

Query: 147 SLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYA 206
           + +YPF KR    PQVVLG  F   + +G+ A+  S     + L +  I W V +DT YA
Sbjct: 113 AWVYPFMKRVTHLPQVVLGAAFGWSIPMGFAAVSESLPLVCWLLLLANICWTVAYDTQYA 172

Query: 207 HQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFMVAFCLLTVNFFAWIGLLI-A 264
             D+ DD  IGV STA LF  Q KL + +L     VL   + + +     F W  LL  A
Sbjct: 173 MVDRDDDLKIGVKSTAILFGQQDKLIIGLLQLATLVLMVAIGWLMNLGGAFYWSVLLAGA 232

Query: 265 LFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           LF+  +++IA        C   F +   VG+++ + ++IS
Sbjct: 233 LFVHQQKMIA--GRQRDPCFRAFLNNNYVGLVLFLGILIS 270


>gi|302662371|ref|XP_003022842.1| UbiA prenyltransferase family protein [Trichophyton verrucosum HKI
           0517]
 gi|291186807|gb|EFE42224.1| UbiA prenyltransferase family protein [Trichophyton verrucosum HKI
           0517]
          Length = 395

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 111/211 (52%), Gaps = 14/211 (6%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R    TG +    PCL+ST+LAA PL          + W+  ++  GA+V RGA
Sbjct: 86  PYAELIRLDKPTGTYYLYFPCLFSTLLAA-PLAVPMATPLE-VAWFSGLFFAGALVMRGA 143

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL D ++D  V RT+ RP+     T   A+VF   Q L    +LLQF PF  C  
Sbjct: 144 GCTINDLWDRNLDPHVERTKFRPIARRAITPKHAIVFTGAQLLSGLAILLQF-PFE-CFW 201

Query: 141 FA---LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHAS-FSWPAFFLCIGTIF 196
           +A   LLF++  YP +KR    PQ +LG+ F+ G  +G+ AL     S P+      +++
Sbjct: 202 YATPSLLFVA-AYPLAKRVTNYPQAMLGLTFSWGAVMGFPALGVEVLSDPSILAACASLY 260

Query: 197 -----WVVYFDTVYAHQDKKDDELIGVNSTA 222
                W + +DT+YAH D KDD   G+ S A
Sbjct: 261 ASNVAWTILYDTIYAHMDVKDDAKAGIKSIA 291


>gi|186893724|ref|YP_001870836.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia
           pseudotuberculosis PB1/+]
 gi|254790309|sp|B2K1U4|UBIA_YERPB RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|186696750|gb|ACC87379.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia
           pseudotuberculosis PB1/+]
          Length = 288

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 95/285 (33%), Positives = 140/285 (49%), Gaps = 13/285 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  LA   +  A +L          ++++G    R A 
Sbjct: 13  YCRLMRIDKPIGSLLLLWPTLWALWLAGRGIPEAKIL---------VVFVLGVFFMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  IDS V RT SRPLPSG  +  ++ +  V+  L+SF L+L  N   I +  
Sbjct: 64  CVVNDYADRHIDSFVKRTASRPLPSGTISEKESKILFVVLILLSFGLVLTLNSMTIWLSL 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++ +YPF KR    PQVVLG  F   + +G+ A+  S     + L +  I W V +
Sbjct: 124 AALALAWIYPFMKRVTHLPQVVLGAAFGWSIPMGFAAVSESLPLVCWLLLLANICWTVAY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN--FFAWI 259
           DT YA  D+ DD  IGV STA LF    KL + +L    +L  +    L+ +   F+  I
Sbjct: 184 DTQYAMVDRDDDLRIGVKSTAILFGQHDKLIIGLLQLATLLLMVAIGWLMNLGGAFYWSI 243

Query: 260 GLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            L  ALF   +++IA      + C   F +   VG+++ + ++IS
Sbjct: 244 LLAGALFTHQQKMIAQ--REREPCFRAFLNNNYVGLVLFLGILIS 286


>gi|218248425|ref|YP_002373796.1| 4-hydroxybenzoate polyprenyltransferase [Cyanothece sp. PCC 8801]
 gi|218168903|gb|ACK67640.1| 4-hydroxybenzoate polyprenyl transferase [Cyanothece sp. PCC 8801]
          Length = 292

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 79/247 (31%), Positives = 120/247 (48%), Gaps = 19/247 (7%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAY---PLRRAGVLGWSTIFWYLFIYIVGAIVTRG 79
           + L RW    G  + ++P LW+  LAA    PL   GV+            I+G++ T  
Sbjct: 17  IRLLRWDKPAGRLILMIPALWAVFLAAKGTPPLPLVGVI------------ILGSLATSA 64

Query: 80  AACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICV 139
           A C  NDL D +ID QV RTR+RPL     +    +V AV+    + +L    N     +
Sbjct: 65  AGCVINDLWDREIDPQVERTRTRPLAEKSLSIKVGIVIAVIALGCAAILAFYLNSLSFWL 124

Query: 140 GFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVV 199
             A + + + YP +KR    PQ+VL   +   V + W A+ A      + L   T+FW +
Sbjct: 125 CVAAVPVIVCYPLAKRVFPIPQLVLSFAWGFAVLISWTAVTAKLELSTWILWAATVFWTL 184

Query: 200 YFDTVYAHQDKKDDELIGVNSTARLFS--YQTKLWLFILYGIFVLCFMVAFCLLTVNFFA 257
            FDTVYA  D++DD  IG+NS+A  F       + LF +  + +L ++    +L +N + 
Sbjct: 185 GFDTVYAMSDREDDRKIGINSSALFFGDYAAEAVGLFFVLAVGLLAYLGE--ILEMNLWF 242

Query: 258 WIGLLIA 264
           W  L IA
Sbjct: 243 WGSLGIA 249


>gi|327301775|ref|XP_003235580.1| 4-hydroxybenzoate polyprenyl transferase [Trichophyton rubrum CBS
           118892]
 gi|326462932|gb|EGD88385.1| 4-hydroxybenzoate polyprenyl transferase [Trichophyton rubrum CBS
           118892]
          Length = 382

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 78/211 (36%), Positives = 111/211 (52%), Gaps = 14/211 (6%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R    TG +    PCL+ST+LAA PL          + W+  ++  G++V RGA
Sbjct: 86  PYAELIRLDKPTGTYYLYFPCLFSTLLAA-PLAMPTATPLE-VAWFSGLFFAGSLVMRGA 143

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL D ++D  V RT+ RP+     T   A++F   Q L    +LLQF PF  C  
Sbjct: 144 GCTINDLWDRNLDPHVERTKFRPIARRAITPKHAIIFTGAQLLSGLAILLQF-PFE-CFW 201

Query: 141 FA---LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHAS-FSWPAFFLCIGTIF 196
           +A   LLF++  YP +KR    PQ +LG+ F+ G  +G+ AL     S P+      +++
Sbjct: 202 YATPSLLFVA-AYPLAKRVTNYPQAMLGLTFSWGAVMGFPALGVEVLSDPSILAACASLY 260

Query: 197 -----WVVYFDTVYAHQDKKDDELIGVNSTA 222
                W + +DT+YAH D KDD   G+ S A
Sbjct: 261 ASNVAWTILYDTIYAHMDVKDDAKAGIKSIA 291


>gi|317493426|ref|ZP_07951847.1| 4-hydroxybenzoate polyprenyl transferase [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316918369|gb|EFV39707.1| 4-hydroxybenzoate polyprenyl transferase [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 285

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 87/165 (52%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L ++ +G    R A C  ND  D  +D  V RT  RPLPSG  T  ++    V+  LISF
Sbjct: 45  LVVFTLGVFFMRAAGCVVNDFADRRVDGHVKRTAQRPLPSGAVTEKESKALFVILVLISF 104

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
            L+L  N   I +  A L ++ +YPF KRF   PQVVLG+ F   + + + A+  S    
Sbjct: 105 GLVLTLNAMTIWLSVAGLALAWVYPFMKRFTHLPQVVLGMAFGWSIPMAYAAVSESLPLS 164

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
            + L +  I W V +DT YA  D+ DD  IG+ STA LF    KL
Sbjct: 165 CWLLFLANICWTVAYDTQYAMVDRDDDLKIGIKSTAILFGRFDKL 209


>gi|260913424|ref|ZP_05919903.1| 4-hydroxybenzoate polyprenyl transferase [Pasteurella dagmatis ATCC
           43325]
 gi|260632498|gb|EEX50670.1| 4-hydroxybenzoate polyprenyl transferase [Pasteurella dagmatis ATCC
           43325]
          Length = 291

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 124/247 (50%), Gaps = 10/247 (4%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQAL-VFAVLQFLIS 125
           L I+++G IV R A C  ND  D  ID  V RT  RPL +G     +A  +FA+L F  S
Sbjct: 50  LTIFVLGVIVMRAAGCVINDYADRHIDGSVKRTSQRPLATGAAAPKEAKWLFAILIF-CS 108

Query: 126 FVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW 185
           F+L+L  N + I + F   F++ +YPF KR+   PQ+ LG+ F   + + +GA   +   
Sbjct: 109 FILVLFLNTYAIALSFIAAFLAFIYPFMKRYTHLPQLFLGMAFGWSIPMAYGASIEALPL 168

Query: 186 PAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFS-YQTKLWLFILYGIFVLCF 244
             + L +  + W V +DT YA  D+ DD  IGV STA LF+ Y  K  +  L  I  LCF
Sbjct: 169 ECWLLFLANLAWTVAYDTQYAMVDRDDDLRIGVKSTAILFAQYDNK--IISLLQIITLCF 226

Query: 245 MVAFCLLT---VNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICL 301
           +     L+   +++FA   L IA    + +   +     + C   F +    G ++ I  
Sbjct: 227 LGTIGYLSQLHISYFAV--LFIATLFFVYQCKLIKDRERESCFKAFLNNNYFGAMVFIAF 284

Query: 302 IISLFLD 308
           +  +F D
Sbjct: 285 LCGIFFD 291


>gi|167580662|ref|ZP_02373536.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia thailandensis
           TXDOH]
          Length = 287

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 63/177 (35%), Positives = 94/177 (53%), Gaps = 4/177 (2%)

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           I+++G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV   L+SF+L
Sbjct: 46  IFVLGTLLMRSAGCAINDYADRDFDRHVKRTAERPLTSGKIRAWEAVAIAVGLALVSFLL 105

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           +L  N     +    +F++  YPF KRF   PQ  LGI F  G+ + + A+  +    A+
Sbjct: 106 ILPLNALTKELSVVAVFVAATYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPALAW 165

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY----GIFV 241
            L    +FW V +DT YA  D+ DD  IG+ ++A  F     L + + Y    GI+V
Sbjct: 166 MLLAANVFWSVAYDTAYAMVDRDDDLKIGMRTSAITFGRHDVLAIMLCYAAMLGIYV 222


>gi|157804072|ref|YP_001492621.1| 4-hydroxybenzoate polyprenyltransferase [Rickettsia canadensis str.
           McKiel]
 gi|157785335|gb|ABV73836.1| 4-hydroxybenzoate octaprenyltransferase [Rickettsia canadensis str.
           McKiel]
          Length = 280

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 75/230 (32%), Positives = 117/230 (50%), Gaps = 2/230 (0%)

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           ++I+G+I TR + C  ND+ D   D  V RT+ RPL SG  +   A+    +  +ISF +
Sbjct: 47  LFILGSITTRSSGCIINDIFDRKFDKHVARTKDRPLASGALSVAYAMFIFFILSIISFFI 106

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           LL  +   I  GF  + +  +YP  KR    PQ+ +G  F  G  + + A+       A 
Sbjct: 107 LLLLSKTAIYTGFFAVIMISIYPLMKRITYFPQIFMGFTFNLGALIAYAAVQDKLDVTAI 166

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNS-TARLFSYQTKLWLFILYGIFVLCFMVA 247
            + +   FW   +DT+Y   D KDD+ IGV S +  L +   K WL+I Y  F+L F++A
Sbjct: 167 IMYLACCFWATGYDTIYGFMDIKDDKKIGVKSLSVYLENKHYKFWLYICYIGFILLFILA 226

Query: 248 FCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
             +   N   ++ +L AL L I ++  L+I     C + F +   VGIL+
Sbjct: 227 TKIANHN-INYLPILAALILLILQVATLEIQNPANCITRFRANNYVGILL 275


>gi|46138197|ref|XP_390789.1| hypothetical protein FG10613.1 [Gibberella zeae PH-1]
          Length = 337

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 111/220 (50%), Gaps = 7/220 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PYV L+R     G  L   P L+  V AA  ++ + +   S + +   I  +G+      
Sbjct: 49  PYVQLSRLSPPVGLILIYFPHLFGVVHAAS-VQSSSI---SEVLYISSILAIGSFFCNNG 104

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
           +  WNDLVD  ID+++ RT+ RP+P G  +R  A  F+V Q +++   LL          
Sbjct: 105 SHAWNDLVDAPIDAKIERTKMRPIPRGAISRQAAFAFSVSQAILAAACLLPLGFETALAT 164

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP---AFFLCIGTIFW 197
              +  +L YPF+KR     QVVLG     GV VG  ++     W    A  L + +  W
Sbjct: 165 IPTILATLYYPFAKRHTYFAQVVLGFCLTWGVMVGSSSMGVEAPWKQESAVSLLLASNLW 224

Query: 198 VVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY 237
           V+ FDTVYAHQD +DD  +GV S A LF+ + +  L+ L+
Sbjct: 225 VILFDTVYAHQDLEDDLKVGVKSLAVLFNGRARPLLWTLF 264


>gi|206561635|ref|YP_002232400.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia cenocepacia
           J2315]
 gi|198037677|emb|CAR53620.1| putative 4-hydroxybenzoate transmembrane octaprenyltransferase
           [Burkholderia cenocepacia J2315]
          Length = 297

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 65/198 (32%), Positives = 102/198 (51%), Gaps = 12/198 (6%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L I+ +G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV    I+F
Sbjct: 54  LVIFTLGTLLMRSAGCAMNDYADRDFDRHVKRTADRPLTSGKIHAWEAVAIAVGLSFIAF 113

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+L  N     +    LF++  YPF KRF   PQ  LGI F  G+ + + A+  +    
Sbjct: 114 LLILPLNTLTKQLSVVALFVAGSYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPML 173

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV 246
           A+ + +  IFW V +DT YA  D+ DD  IG+ ++A            + +G F +  ++
Sbjct: 174 AWVMLVANIFWSVAYDTEYAMVDRDDDIKIGIRTSA------------LTFGRFDVAAVI 221

Query: 247 AFCLLTVNFFAWIGLLIA 264
           A   +T+  + WIG+ + 
Sbjct: 222 ACYAMTLGIYVWIGVTLG 239


>gi|304415223|ref|ZP_07395931.1| p-hydroxybenzoate octaprenyltransferase [Candidatus Regiella
           insecticola LSR1]
 gi|304282929|gb|EFL91384.1| p-hydroxybenzoate octaprenyltransferase [Candidatus Regiella
           insecticola LSR1]
          Length = 293

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 92/297 (30%), Positives = 150/297 (50%), Gaps = 13/297 (4%)

Query: 10  VRDCIMGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFI 69
           ++  ++ S    Y ++ R     G  L + P LW+  LA     + G+L  +     L +
Sbjct: 6   LKRQVIQSKWKAYCHVMRLDKPIGSLLLLWPTLWALWLA-----QRGMLDITI----LMV 56

Query: 70  YIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLL 129
           +++G  + R A C  ND VD DID  V RT +RPL SG  + +++ +  V+  L +F L+
Sbjct: 57  FVLGVFLMRAAGCVINDYVDRDIDGHVKRTVNRPLVSGAISAYESKILFVVLLLFAFALV 116

Query: 130 LQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFF 189
           L  N   I +    L ++ +YPF KR    PQVVLG+ F   + +G+ A+ +S     + 
Sbjct: 117 LTLNRMTIELSLVALALAWIYPFMKRITHLPQVVLGVAFGWSIPMGFSAVSSSLPLVCWL 176

Query: 190 LCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFC 249
           L +  I W + +DT YA  D+ DD  IGV STA LF    KL +  L  + +L  +    
Sbjct: 177 LLLANICWTITYDTQYAMVDRDDDLKIGVKSTAILFGQYDKLVIGALQLVTLLLMITVGY 236

Query: 250 LLTVNFFAWIGLLIA--LFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           L+ ++   +  +LIA  LFL  ++IIA        C   F +   VG+++ + ++ S
Sbjct: 237 LMQLDNVFYYSILIAGVLFLYQQKIIA--NREPNGCFRAFLNNNYVGLILFLGILFS 291


>gi|300724729|ref|YP_003714054.1| p-hydroxybenzoate octaprenyltransferase [Xenorhabdus nematophila
           ATCC 19061]
 gi|297631271|emb|CBJ91966.1| p-hydroxybenzoate octaprenyltransferase [Xenorhabdus nematophila
           ATCC 19061]
          Length = 288

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 90/279 (32%), Positives = 134/279 (48%), Gaps = 15/279 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R +   G  L + P  W+  +AA  +    VL          ++ +G    R A 
Sbjct: 13  YCRLMRVNKPIGALLLLWPTYWALWIAAKGMPDLHVL---------LVFTIGVFSMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLISFVLLLQFNPFVICVG 140
           C  ND  D   D  V RT+SRPLPSG  T  ++ ++FA L F ISF L+L  N   + + 
Sbjct: 64  CCINDFADRKFDGYVERTKSRPLPSGDITEKESKILFATLVF-ISFALVLTLNKMTMALS 122

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              L ++ +YPF KR    PQVVLG  +   + + + A+  S     + L +  + W V 
Sbjct: 123 IVGLALAWIYPFVKRVSHLPQVVLGAAYGWSIPMAFAAVSESLPLECWLLFLANVIWSVI 182

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTV-NFFAWI 259
           +DT YA  D+ DD  IGV STA LF    KL + IL  I ++  +    ++ +   + W 
Sbjct: 183 YDTQYAMVDRDDDLKIGVKSTAVLFGRFDKLIIGILQFIMLVILVSVGNMINLGGIYYWT 242

Query: 260 GLL-IALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
            LL  ALF+  +++IA        C   F +   VGI++
Sbjct: 243 ILLAAALFIYQQKLIAG--RERALCFQAFMNNNYVGIIL 279


>gi|167855825|ref|ZP_02478577.1| 4-hydroxybenzoate octaprenyltransferase [Haemophilus parasuis
           29755]
 gi|167853038|gb|EDS24300.1| 4-hydroxybenzoate octaprenyltransferase [Haemophilus parasuis
           29755]
          Length = 290

 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 110/212 (51%), Gaps = 12/212 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L R     G  L + P LW+    A  +    +L          I+++G IV R A 
Sbjct: 13  YMQLMRLDKPIGTFLLLWPTLWALFAVADGVPPLPIL---------IIFLLGVIVMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLISFVLLLQFNPFVICVG 140
           C  ND  D  ID  V RT  RPL +G+ T  +A ++FA L F I+F+L+LQ N + + + 
Sbjct: 64  CVINDYADRHIDGNVKRTSQRPLATGRATAKEAKILFATLIF-IAFLLVLQLNLYTLGLS 122

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
              + ++ +YPF KR+   PQ VLG+ F   + + +GA+  +     + L    + W V 
Sbjct: 123 VIAVALATVYPFMKRYTHLPQFVLGMAFGWSIPMAYGAVSETLPLECWLLFFANLAWTVA 182

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFS-YQTKL 231
           +DT YA  D+ DD  IGV STA LF+ Y  K+
Sbjct: 183 YDTQYAMVDRDDDLRIGVKSTAILFAQYDNKI 214


>gi|238764121|ref|ZP_04625075.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia kristensenii ATCC
           33638]
 gi|238697658|gb|EEP90421.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia kristensenii ATCC
           33638]
          Length = 273

 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 92/280 (32%), Positives = 136/280 (48%), Gaps = 13/280 (4%)

Query: 27  RWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWND 86
           R     G  L + P LW+  LA   +    +L          ++++G    R A C  ND
Sbjct: 2   RIDKPIGSLLLLWPTLWALWLAGKGIPDTNIL---------IVFVLGVFFMRAAGCVVND 52

Query: 87  LVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFI 146
             D +ID  V RT SRPLPSG  +  ++ +  V+  L+SF L+L  N   I +  A L +
Sbjct: 53  YADRNIDGFVKRTASRPLPSGLISEKESKILFVILVLLSFGLVLTLNNMTIWLSLAALAL 112

Query: 147 SLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYA 206
           + +YPF KR    PQVVLG  F   + +G+ A+  S     + L +  I W V +DT YA
Sbjct: 113 AWVYPFMKRVTHLPQVVLGAAFGWSIPMGFAAVSESLPLVCWLLLLANICWTVAYDTQYA 172

Query: 207 HQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFMVAFCLLTVNFFAWIGLLI-A 264
             D+ DD  IGV STA LF    KL + +L     VL  ++ + +     F W  LL  A
Sbjct: 173 MVDRDDDLRIGVKSTAILFGQHDKLIIGLLQLATLVLMVVIGWLMDLGGSFYWAILLAGA 232

Query: 265 LFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           LF+  +++IA        C   F +   VG+++ + + IS
Sbjct: 233 LFVHQQKMIAR--RERDPCFRAFLNNNYVGLVLFLGIFIS 270


>gi|187929989|ref|YP_001900476.1| 4-hydroxybenzoate octaprenyltransferase [Ralstonia pickettii 12J]
 gi|187726879|gb|ACD28044.1| 4-hydroxybenzoate polyprenyl transferase [Ralstonia pickettii 12J]
          Length = 280

 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 101/201 (50%)

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           I+ VG  + R A C  ND  D D D  V RT+ RP+ +G    ++AL  A +  LI+F L
Sbjct: 41  IFTVGTFLMRSAGCAVNDWADRDFDKHVKRTKERPITAGLIAPWEALAVAAVLSLIAFTL 100

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           +L  N     +  A + I+  YPF KRF   PQ  LGI F  G+ + + A+       A+
Sbjct: 101 ILPLNALTKWMSVAAIVIAGTYPFFKRFFAIPQAYLGIAFGFGIPMAYAAVQDQVPVLAW 160

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAF 248
            +  G +FW V +DT YA  D+ DD LIG+ ++A  F       + + Y  F      A 
Sbjct: 161 LMLAGNVFWAVAYDTAYAMVDRDDDLLIGIKTSAITFGRFDVAAIMLCYAGFFGIMAWAG 220

Query: 249 CLLTVNFFAWIGLLIALFLTI 269
            ++ ++   WIG   A+ L++
Sbjct: 221 HVMALSVAYWIGFAAAVALSL 241


>gi|284929233|ref|YP_003421755.1| 4-hydroxybenzoate polyprenyltransferase-like prenyltransferase
           [cyanobacterium UCYN-A]
 gi|284809677|gb|ADB95374.1| 4-hydroxybenzoate polyprenyltransferase-like prenyltransferase
           [cyanobacterium UCYN-A]
          Length = 297

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 89/286 (31%), Positives = 145/286 (50%), Gaps = 15/286 (5%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           + L RW   TG  + ++P LW+  LA+     + ++          I I+G++ T  A C
Sbjct: 18  IQLLRWDKPTGRLILMIPALWALFLASRGFPPSSLI---------LIIILGSLSTSSAGC 68

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFN--PFVICVG 140
             NDL D +ID QV RT++RPL S   +    +V A +  + + VL L  N   F++C+ 
Sbjct: 69  VINDLWDRNIDPQVKRTKNRPLASRTLSIQVGIVTAFISLVCALVLSLYLNTLSFLLCI- 127

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A+ FI + YP +K+F   PQ++L + +   V + W A+     +  F L   T+FW + 
Sbjct: 128 LAVPFI-VCYPLAKKFFPIPQLILSLSWGFAVLISWTAVTQKLEFDTFILWAITVFWTLG 186

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           FDTVYA  D+ DD+ IGVNS+A  F    +  +  ++      +      + +NF  WI 
Sbjct: 187 FDTVYAMSDRDDDKKIGVNSSALFFGQHAENIIACIFAFTASLWAYLAINMQLNFCFWIT 246

Query: 261 LLIALFLTIKRIIALDISCSKQCC--SFFHSAGVVGILILICLIIS 304
           L+IA  + IK+ I L    + Q      F     +G+++L+ +I S
Sbjct: 247 LVIASGMWIKQCILLKSPNTPQKLYEQIFRENVYLGLILLVGIIAS 292


>gi|123444036|ref|YP_001008006.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|167011560|sp|A1JRU3|UBIA_YERE8 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|122090997|emb|CAL13880.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 288

 Score =  115 bits (288), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 94/285 (32%), Positives = 137/285 (48%), Gaps = 13/285 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  LA   +    +L          ++++G    R A 
Sbjct: 13  YCRLMRIDKPIGSLLLLWPTLWALWLAGKGIPDTKIL---------IVFVLGVFFMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  ID  V RT SRPLPSG  +  ++ +  V+  L+SF L+L  N   I +  
Sbjct: 64  CVVNDYADRRIDGFVKRTASRPLPSGLISERESKILFVVLVLLSFGLVLTLNSMTIWLSL 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++ +YPF KR    PQVVLG  F   + +G+ A+  +     + L +  I W V +
Sbjct: 124 AALALAWVYPFMKRVTHLPQVVLGAAFGWSIPMGFAAVSENLPLVCWLLLLANICWTVAY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFMVAFCLLTVNFFAWIG 260
           DT YA  D+ DD  IGV STA LF  Q KL + +L     VL   + + +     F W  
Sbjct: 184 DTQYAMVDRDDDLKIGVKSTAILFGQQDKLIIGLLQLATLVLMVTIGWLMNLGGAFYWSI 243

Query: 261 LLI-ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           LL  ALF+  +++IA        C   F +   VG+++ + + IS
Sbjct: 244 LLAGALFVHQQKMIA--GRERDPCFRAFLNNNYVGLVLFLGIFIS 286


>gi|157148068|ref|YP_001455387.1| 4-hydroxybenzoate octaprenyltransferase [Citrobacter koseri ATCC
           BAA-895]
 gi|166988443|sp|A8AN88|UBIA_CITK8 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|157085273|gb|ABV14951.1| hypothetical protein CKO_03875 [Citrobacter koseri ATCC BAA-895]
          Length = 289

 Score =  115 bits (288), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 123/247 (49%), Gaps = 12/247 (4%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
            W L +++ G  + R A C  ND  D   D  V RT +RPLPSG  T  +A    V+   
Sbjct: 46  LWILAVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARTLFVVLVA 105

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           +SF+L+L  N   I +  A L ++ +YPF KR+   PQVVLG  F   + + + A+  S 
Sbjct: 106 LSFLLVLTLNTMTILLSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESV 165

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
               + + +  I W V +DT YA  D+ DD  IG+ STA LF    KL + IL  I VL 
Sbjct: 166 PLSCWLMFLANILWAVAYDTQYAMVDRDDDLKIGIKSTAILFGRHDKLIIGILQ-IAVLA 224

Query: 244 FMVAFCLLTVNFFAW-----IGLLIALFLTIKRIIALDISCSKQCC-SFFHSAGVVGILI 297
            M     L  N   W     + +  ALF+  +++I   +   ++ C   F +   VG+++
Sbjct: 225 LMALIGWL--NGLGWGYYWSVLVAGALFVYQQKLI---VGREREACFKAFMNNNYVGLVL 279

Query: 298 LICLIIS 304
            + L +S
Sbjct: 280 FLGLAMS 286


>gi|90412716|ref|ZP_01220717.1| putative 4-hydroxybenzoate octaprenyltransferase [Photobacterium
           profundum 3TCK]
 gi|90326291|gb|EAS42710.1| putative 4-hydroxybenzoate octaprenyltransferase [Photobacterium
           profundum 3TCK]
          Length = 287

 Score =  115 bits (288), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 88/286 (30%), Positives = 137/286 (47%), Gaps = 13/286 (4%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           LAR+    G  L + P LW+  LAA  L    VL          ++++G I  R A C  
Sbjct: 13  LARFDRPIGSLLLLWPTLWALFLAADGLPNIHVL---------VVFVLGVIFMRAAGCVI 63

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND  D + D  V RT  RP+PSG+ +  +AL    L  L+SF+L+L  N   I +    L
Sbjct: 64  NDFADRNFDGHVKRTAERPMPSGKVSEREALGLFGLLVLVSFLLVLTMNTLTIMLSVVGL 123

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            ++  YPF KR+   PQ+VLG+ F   + + + A        A+ L    I W + +DT 
Sbjct: 124 ALAAAYPFMKRYTHLPQLVLGMAFGWSIPMAYAAQAGELPVVAWLLFTANILWTIAYDTQ 183

Query: 205 YAHQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFMVAFCLLTVNFFAWIGLLI 263
           YA  D+ DD  +G+ S A LF    K+ + +L     V+  ++   L     + W  L+ 
Sbjct: 184 YAMVDRDDDLKVGIKSAAILFGRFDKIIIGVLQLSTLVIMILIGHSLDLHQVYYWFLLMA 243

Query: 264 A-LFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLD 308
           + LF+  +R+I       + C   F +   VG+LI + + IS+ + 
Sbjct: 244 SGLFVYQQRLIGR--REREPCFKAFLNNNYVGMLIFLGIAISVMMQ 287


>gi|37522997|ref|NP_926374.1| 4-hydroxybenzoate polyprenyltransferase [Gloeobacter violaceus PCC
           7421]
 gi|35214000|dbj|BAC91369.1| 4-hydroxybenzoate-octaprenyl transferase [Gloeobacter violaceus PCC
           7421]
          Length = 292

 Score =  115 bits (288), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 86/279 (30%), Positives = 127/279 (45%), Gaps = 10/279 (3%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           L RW    G  + ++P LW    AA         G S     + + +VG I T  A C  
Sbjct: 18  LLRWDKPAGRLILMIPALWGVFAAA---------GGSPSPLLVLVMVVGTIATSAAGCVI 68

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           NDL D DID  V RTR+RPL S +     A+V   +  L ++ L    NPF   +  A +
Sbjct: 69  NDLWDRDIDPLVERTRARPLASRELAVPVAVVTFAVSLLCAWGLTFFLNPFTFWLCVAAV 128

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            +  LYP +KR    PQ+VL + +     + W A+      PA++L   T+ W + FDTV
Sbjct: 129 PVIALYPGAKRVFPVPQLVLSLAWGFAALISWSAVTGGLETPAWWLWGATVLWTLGFDTV 188

Query: 205 YAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIA 264
           YA  D++DD  IG+NS+A  F   T   +   +    LC  V    L +    ++ L++A
Sbjct: 189 YALSDREDDLKIGINSSAIFFGRFTPEAIAAFFAGAALCLAVVGYQLELGSIFYVCLIVA 248

Query: 265 LFLTIKRIIALDISCSK-QCCSFFHSAGVVGILILICLI 302
                +   +L       +    F+    VG +IL  LI
Sbjct: 249 TLFWWREYRSLVTGDDPARFNRIFNENVTVGFVILTGLI 287


>gi|331005853|ref|ZP_08329205.1| 4-hydroxybenzoate polyprenyltransferase [gamma proteobacterium
           IMCC1989]
 gi|330420297|gb|EGG94611.1| 4-hydroxybenzoate polyprenyltransferase [gamma proteobacterium
           IMCC1989]
          Length = 289

 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 104/215 (48%), Gaps = 9/215 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S+I PY  L R+H   G  L + P  W+  LAA      G     T    LFI+ +G I+
Sbjct: 7   SSIKPYWELMRFHKPIGILLLLWPTYWALWLAA-----GGFPNPQT----LFIFTLGVII 57

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  ND+ D  +D  V RT  RP+ SGQ +   A    +    ++FV +L  N   
Sbjct: 58  MRAAGCIINDIADRHVDGHVKRTEGRPIVSGQVSVKNAYYLLIAMVSVAFVAVLFTNTLT 117

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I +  A   ++  YPF KR+   PQVVLG+ F+  + + + A         + L    + 
Sbjct: 118 IYLSLAAAALAFCYPFMKRYTHLPQVVLGMAFSMSIPMAFAAQTGKLDPALWLLYTTNVL 177

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
           W V +DT Y   D++ D+ IGV STA LF    +L
Sbjct: 178 WTVAYDTFYGMADREYDKRIGVKSTAILFEENDRL 212


>gi|225023565|ref|ZP_03712757.1| hypothetical protein EIKCOROL_00424 [Eikenella corrodens ATCC
           23834]
 gi|224943660|gb|EEG24869.1| hypothetical protein EIKCOROL_00424 [Eikenella corrodens ATCC
           23834]
          Length = 295

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/231 (28%), Positives = 114/231 (49%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
           F  LF +++G  + R A C  ND  D + D  V RT+SRP  +G+ +  +A++  +    
Sbjct: 51  FGILFAFVLGTFLMRSAGCVVNDFADRNFDGAVARTKSRPFATGKVSTREAMLLLLALCA 110

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
            + + LL  N     +    LF++L YPF+KRF   PQ+ LG+ F+ G+ + + A+    
Sbjct: 111 AACLCLLPLNALTKLMSLPALFLALSYPFTKRFFPLPQLYLGLAFSFGIPMAFAAVQNHV 170

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLC 243
              A+ L      W + +DT+YA  DK+DD  IG+ ++A  F  +      + + +FVL 
Sbjct: 171 PPLAWLLFAANACWTLAYDTIYAMADKEDDLKIGIQTSAITFGRRDAEAAMLCHALFVLL 230

Query: 244 FMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVG 294
              A C +   +  W+ L+ A++    +  A+     + C   F S   +G
Sbjct: 231 MAAAGCTIHARWPYWLALVYAVWHQFGQYRAIRSRNREACFKVFLSNNRIG 281


>gi|254467912|ref|ZP_05081318.1| 4-hydroxybenzoate octaprenyltransferase [beta proteobacterium KB13]
 gi|207086722|gb|EDZ64005.1| 4-hydroxybenzoate octaprenyltransferase [beta proteobacterium KB13]
          Length = 285

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 111/226 (49%), Gaps = 15/226 (6%)

Query: 15  MGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGA 74
           M      Y+ LAR     G  L + P +W+ +L+     R         F  L I+ +G 
Sbjct: 1   MNKYFYSYLKLARLDKPVGILLLLWPTIWALILSTEGQIR---------FQDLLIFCIGV 51

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
           I+TR A C  ND+ DHDIDS+V RT +RPL   + T   A +F +   L +  LL   + 
Sbjct: 52  ILTRSAGCVINDIFDHDIDSKVKRTSNRPLAQKELTLKNASIFFLFLSLGALSLLFFLHS 111

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFS---WPAFFLC 191
           + I +     F+ ++YP SKRF   PQ+ LG+ F+  V V +  +  S     W  FFL 
Sbjct: 112 YAIKIICVSAFLLMVYPLSKRFFPIPQLFLGLAFSSTVLVVFAHVQQSLPLECWILFFLN 171

Query: 192 IGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY 237
                WV+ +DTVYA  D  DD  + ++S+ +LF   T   + + Y
Sbjct: 172 FS---WVMAYDTVYAKADFTDDINLSIHSSPKLFKKYTNHAIVVFY 214


>gi|170702352|ref|ZP_02893245.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia ambifaria
           IOP40-10]
 gi|170132737|gb|EDT01172.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia ambifaria
           IOP40-10]
          Length = 290

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 88/161 (54%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L I+++G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV+   ISF
Sbjct: 44  LAIFVLGTLLMRSAGCAMNDYADRDFDRHVKRTADRPLTSGKIRAWEAVAIAVVLAFISF 103

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+   N     +    LF++  YPF KRF   PQ  LGI F  G+ + + A+  +    
Sbjct: 104 LLIQPLNTLTKELSVVALFVAGSYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPML 163

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSY 227
           A+ + I  IFW V +DT YA  D+ DD  IG+ ++A  F +
Sbjct: 164 AWVMLIANIFWSVAYDTEYAMVDRDDDIKIGIRTSALTFGH 204


>gi|153947917|ref|YP_001402727.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia
           pseudotuberculosis IP 31758]
 gi|167011561|sp|A7FN99|UBIA_YERP3 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|152959412|gb|ABS46873.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia
           pseudotuberculosis IP 31758]
          Length = 288

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 94/285 (32%), Positives = 139/285 (48%), Gaps = 13/285 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  LA   +  A +L          ++++G    R A 
Sbjct: 13  YCRLMRIDKPIGSLLLLWPTLWALWLAGRGIPEAKIL---------VVFVLGVFFMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  ID  V RT SRPLPSG  +  ++ +  V+  L+SF L+L  N   I +  
Sbjct: 64  CVVNDYADRHIDGFVKRTASRPLPSGTISEKESKILFVVLILLSFGLVLTLNSMTIWLSL 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++ +YPF KR    PQVVLG  F   + +G+ A+  S     + L +  I W V +
Sbjct: 124 AALALAWIYPFMKRVTHLPQVVLGAAFGWSIPMGFAAVSESLPLVCWLLLLANICWTVAY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN--FFAWI 259
           DT YA  D+ DD  IGV STA LF    KL + +L    +L  +    L+ +   F+  I
Sbjct: 184 DTQYAMVDRDDDLRIGVKSTAILFGQHDKLIIGLLQLATLLLMVAIGWLMNLGGAFYWSI 243

Query: 260 GLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            L  ALF   +++IA      + C   F +   VG+++ + ++IS
Sbjct: 244 LLAGALFTHQQKMIAQ--REREPCFRAFLNNNYVGLILFLGILIS 286


>gi|282600448|ref|ZP_05974301.2| 4-hydroxybenzoate polyprenyl transferase [Providencia rustigianii
           DSM 4541]
 gi|282565363|gb|EFB70898.1| 4-hydroxybenzoate polyprenyl transferase [Providencia rustigianii
           DSM 4541]
          Length = 284

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 121/240 (50%), Gaps = 4/240 (1%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L ++  G  + R A C  ND  D + D  V RT+ RPLPSG  T  +A +        SF
Sbjct: 45  LIVFTAGVFLMRAAGCVINDFADRNFDGYVERTKHRPLPSGDVTEKEAKILFACLVGFSF 104

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+L  N   I +  A L ++ +YPF KR    PQVVLG  F   + +G+ A+  S    
Sbjct: 105 LLVLTLNSMTIWLSVAGLALAWIYPFVKRVSNLPQVVLGAAFGWSIPMGFSAVSESLPLV 164

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFV-LCFM 245
            + L +  I W V +DT YA  D+ DD  IG+ STA LF    KL + +L  + V L  +
Sbjct: 165 CWLLFLVNIIWSVIYDTQYAMVDRNDDLKIGIKSTAILFGNYDKLIIGLLQVVMVGLLVV 224

Query: 246 VAF-CLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           + F   L + ++A + L  ALF+  ++++         C   F +   VG ++ I ++IS
Sbjct: 225 IGFLANLGMVYYAALVLTSALFVYQQQLMV--NRERAPCFKAFMNNNYVGFILFIGMVIS 282


>gi|88858445|ref|ZP_01133087.1| 4-hydroxybenzoate polyprenyltransferase [Pseudoalteromonas tunicata
           D2]
 gi|88820062|gb|EAR29875.1| 4-hydroxybenzoate polyprenyltransferase [Pseudoalteromonas tunicata
           D2]
          Length = 292

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 106/218 (48%), Gaps = 9/218 (4%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           I  Y  L R     G  L + P  W+  LA+      G+  W     ++ ++  G  + R
Sbjct: 11  IEHYSKLMRVDKPIGTLLLLWPTFWALWLAS-----NGLPDWH----FIIVFSAGVFIMR 61

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
            A C  ND  D  +D QV RT+ RPL +G  +  + L    L  + +F+L+L  N   I 
Sbjct: 62  SAGCVINDFADRKVDGQVKRTKDRPLAAGLVSTKETLQLFALLIITAFLLVLTLNYQTIL 121

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           + F  L ++  YPF KR+   PQVVLG  F+  + + + A+  S    A+ L    + W 
Sbjct: 122 LSFVALLLAFSYPFMKRYTHLPQVVLGAAFSWSIPMAYMAVGQSVPVEAWMLYGANLLWT 181

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFIL 236
           V +DT+Y   D+ DD  IGV STA LF    KL + +L
Sbjct: 182 VAYDTMYGMVDRDDDIKIGVKSTAILFGRADKLIIAVL 219


>gi|172037477|ref|YP_001803978.1| 4-hydroxybenzoate polyprenyltransferase [Cyanothece sp. ATCC 51142]
 gi|171698931|gb|ACB51912.1| 4-hydroxybenzoate-octaprenyl transferase [Cyanothece sp. ATCC
           51142]
          Length = 295

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 86/290 (29%), Positives = 139/290 (47%), Gaps = 15/290 (5%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           + L RW    G  + ++P LW+  LAA  +    ++G         + I+G + T  A C
Sbjct: 17  IRLLRWDKPAGRLILMIPALWAIFLAARGVPPLPLIG---------VIILGTLATSAAGC 67

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFN--PFVICVG 140
             NDL D DID QV RT++RPL     +    ++ A +    + +L    N   F++CV 
Sbjct: 68  VINDLWDRDIDPQVERTKTRPLADRSLSIKVGIIIAFISLFCAAILAFYLNTLSFILCVA 127

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A+ FI + YP +KR    PQ+VL + +   V + W A+        + L   T+FW + 
Sbjct: 128 -AVPFI-VCYPLAKRVFPIPQLVLSLAWGFAVLISWTAVTGELENDTWVLWGITVFWTLG 185

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           FDTVYA  D++DD+ IGVNS+A  F       + I + I    +      + +N   W+ 
Sbjct: 186 FDTVYAMSDREDDQKIGVNSSALFFGKYAGEAVGIFFAITAGLWAYLGVTMHLNLGFWLT 245

Query: 261 LLIALFLTIKRIIALDISCSKQCC--SFFHSAGVVGILILICLIISLFLD 308
            +IAL   + + I L      Q      F    V+G ++L  +++S+ L+
Sbjct: 246 WIIALVGWMIQYIRLSSPEIPQQTYGQVFRQNVVIGFILLGGILVSIALN 295


>gi|157826105|ref|YP_001493825.1| 4-hydroxybenzoate polyprenyltransferase [Rickettsia akari str.
           Hartford]
 gi|157800063|gb|ABV75317.1| prenyltransferase [Rickettsia akari str. Hartford]
          Length = 280

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 83/274 (30%), Positives = 131/274 (47%), Gaps = 10/274 (3%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           L R      + L   P L+  +LA            + + + L ++I+G+I TR + C  
Sbjct: 11  LMRVDKPVAYLLVFFPALFGLLLAN--------PSNTELAYLLPLFILGSITTRSSGCII 62

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND+ D   D  V RT+ RPL SG  +   A+    +  +IS  +LL  N   I  GF  +
Sbjct: 63  NDIFDRKFDKHVTRTKDRPLASGALSVSYAIFILFILSIISLCILLLLNKTAIYTGFFAV 122

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            +  LYP +KR    PQ+ +G  F  G  + + A+       A  + +   FW   +DT+
Sbjct: 123 IMISLYPLTKRITYFPQIFMGFTFNLGALIAYAAVQDKLDLAAIIIYLACCFWATGYDTI 182

Query: 205 YAHQDKKDDELIGVNS-TARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLI 263
           Y + D KDD+ IGV S +  L +   K WL + Y +F+L F +A  +   N   ++ +L 
Sbjct: 183 YGYMDIKDDKKIGVKSLSIYLENKHPKFWLDVCYIVFILLFTLATKIANRN-IDYLPILA 241

Query: 264 ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
           AL L I ++  LDI     C + F +   VG+L+
Sbjct: 242 ALILLILQVATLDIKNPDYCMTRFRANNYVGVLL 275


>gi|209696294|ref|YP_002264225.1| 4-hydroxybenzoate octaprenyltransferase [Aliivibrio salmonicida
           LFI1238]
 gi|254790260|sp|B6ENU2|UBIA_ALISL RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|208010248|emb|CAQ80579.1| 4-hydroxybenzoate octaprenyltransferase [Aliivibrio salmonicida
           LFI1238]
          Length = 285

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 70/207 (33%), Positives = 102/207 (49%), Gaps = 9/207 (4%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           L R +   G  L + P LW+  LAA      G+  W      L ++I+G +  R A C  
Sbjct: 12  LTRMNRPIGSLLLLWPTLWALFLAA-----DGIPDWHV----LIVFILGVVFMRSAGCVI 62

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND  D  +D  V RT +RPLPSG  +  +AL+   +    SF+L+L  N   I +    +
Sbjct: 63  NDFADRKVDGHVKRTANRPLPSGLVSSKEALILFSVLVTCSFILVLTMNTLTIMLSSIGV 122

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            +++ YPF KR    PQ VLG+ F+  + + + A        A+ L +    W + +DT 
Sbjct: 123 LLAIAYPFMKRITYLPQFVLGLAFSWAIPMAYAAESNQVPPEAWLLFVINAVWTIAYDTQ 182

Query: 205 YAHQDKKDDELIGVNSTARLFSYQTKL 231
           YA  D+ DD  IG+ STA LF    KL
Sbjct: 183 YAMVDRDDDLNIGIKSTAILFGRFDKL 209


>gi|167618765|ref|ZP_02387396.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia thailandensis
           Bt4]
 gi|257138002|ref|ZP_05586264.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia thailandensis
           E264]
 gi|118574195|sp|Q2SZ16|UBIA_BURTA RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
          Length = 287

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 63/177 (35%), Positives = 94/177 (53%), Gaps = 4/177 (2%)

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           I+++G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV   L+SF+L
Sbjct: 46  IFVLGTLLMRSAGCAINDYADRDFDRHVKRTAERPLTSGKIRAWEAVAIAVGLALVSFLL 105

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           +L  N     +    +F++  YPF KRF   PQ  LGI F  G+ + + A+  +    A+
Sbjct: 106 ILPLNALTKELSVVAVFVAATYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPALAW 165

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY----GIFV 241
            L    +FW V +DT YA  D+ DD  IG+ ++A  F     L + + Y    GI+V
Sbjct: 166 MLLAANVFWSVAYDTAYAMVDRDDDLKIGMRTSAITFGRYDVLAIMLCYAAMLGIYV 222


>gi|206603540|gb|EDZ40020.1| Putative 4-hydroxybenzoate polyprenyl transferase [Leptospirillum
           sp. Group II '5-way CG']
          Length = 287

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 86/277 (31%), Positives = 136/277 (49%), Gaps = 15/277 (5%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           L R+    G  L  +P LW  +LAA+        G       + ++  GA V R A C  
Sbjct: 10  LIRFRRPVGTLLLFMPALWG-LLAAW--------GGKPPVSMILLFGTGAFVMRSAGCAI 60

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND++D ++D +V RTR RPLPSG+ +   A +  +   L++  LLL  +P    +  A  
Sbjct: 61  NDILDRNVDGKVWRTRDRPLPSGRLSLRAAWLVFLALSLVAASLLLFLHPLTRMIALAGF 120

Query: 145 FISLLYPFSKRFILCPQVVLGIGFA-GGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDT 203
             ++LYP  KRF+  PQV +GI F      + W     +  WPAF + +G +FW   +D 
Sbjct: 121 GATMLYPLMKRFMPLPQVFMGIPFGMTAPLMAWAEGRGTLDWPAFMIALGGLFWATTYDL 180

Query: 204 VYAHQDKKDDELIGVNSTARLFSYQTKLWLFI-LYGIFVLCFM-VAFCLLTVN-FFAWIG 260
           VYA  D++DD   G+ S A   ++  +LW+ I L+G+    F+  A   L +N F+ W  
Sbjct: 181 VYAIADREDDIKAGICSGA--VTFGDRLWMAILLFGMSSALFLWSAGADLGLNRFYPWTV 238

Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
            +  LF+  + +        +   S F S   +G++I
Sbjct: 239 GIFVLFMVWQSLAVRKGMSPEGALSCFKSHVWIGLII 275


>gi|146329064|ref|YP_001209314.1| 4-hydroxybenzoate polyprenyltransferase [Dichelobacter nodosus
           VCS1703A]
 gi|146232534|gb|ABQ13512.1| 4-hydroxybenzoate polyprenyltransferase [Dichelobacter nodosus
           VCS1703A]
          Length = 287

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 86/290 (29%), Positives = 136/290 (46%), Gaps = 9/290 (3%)

Query: 15  MGSAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGA 74
           +   I+ Y+ L R     G  L +   LW   LA      A +           I ++G 
Sbjct: 4   LSKKISAYIRLMRLDKPVGTLLLMWNSLWGLWLAGNGKPPAKIA---------LILLLGT 54

Query: 75  IVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP 134
              R A C  NDL D  ID  V RTR RPL +G+ + F+A++ ++L FL SF L+LQ N 
Sbjct: 55  WSMRSAGCVINDLADRHIDGFVKRTRYRPLAAGELSVFEAVLISILLFLFSFYLVLQLNR 114

Query: 135 FVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGT 194
             + V         LYPF KRF+  PQ VLGI FA  + +   A+    +     + +G 
Sbjct: 115 PSLLVAVGSALTVFLYPFCKRFLPAPQAVLGIAFASAILLAHTAILGKITLAGGLMFLGG 174

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
            FW + +DT YA  D+ DD  + ++STA L     + ++ ++  + +LC +++       
Sbjct: 175 AFWALVYDTYYALVDRDDDLPLKLHSTAILARGCERRFIALMAALMLLCLILSGIAGGRG 234

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            + ++GLL A  L  + +  +      +C + FH    VG  I   L++ 
Sbjct: 235 SWYYLGLLSAALLMAQELYMIRGFNRARCFAAFHHNNWVGAAIWAGLVLD 284


>gi|330815596|ref|YP_004359301.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia gladioli
           BSR3]
 gi|327367989|gb|AEA59345.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia gladioli
           BSR3]
          Length = 287

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 100/195 (51%), Gaps = 12/195 (6%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L I+I+G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV   ++SF
Sbjct: 44  LVIFILGTLLMRSAGCAINDYADRDFDRHVKRTVDRPLTSGKIRAWEAVAIAVGLAIVSF 103

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+L  N     +    +F++  YPF KRF   PQ  LGI F  G+ + + A+  +    
Sbjct: 104 LLILPLNGLTKWLSVVAVFVAGTYPFLKRFFAIPQAYLGIAFGFGIPMAFAAIQNTVPLI 163

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV 246
           A+ +    +FW V +DT YA  D+ DD  IG+ ++A  F     L         +LC+  
Sbjct: 164 AWVMLAANVFWSVAYDTAYAMVDRDDDLKIGMRTSAITFGRYDVL-------AIMLCYAA 216

Query: 247 AFCLLTVNFFAWIGL 261
            F +     +AWIGL
Sbjct: 217 VFAI-----YAWIGL 226


>gi|49085970|gb|AAT51318.1| PA5358 [synthetic construct]
          Length = 297

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 111/211 (52%), Gaps = 11/211 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           +V L R     G +L + P LWS  +A       GV         L I+++G I+ R A 
Sbjct: 19  FVQLVRLDRPIGIYLLLWPTLWSLWIAT-----DGVPELKN----LLIFVLGVILMRAAG 69

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLISFVLLLQFNPFVICVG 140
           C  ND  D + D  V RT++RPL +G+ +  +A + FAVL  L SF L+L  N   + + 
Sbjct: 70  CVINDFADRNFDGHVARTKARPLATGKISVREAWITFAVLVAL-SFGLVLLTNATTVWLS 128

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
           F  + ++ LYPF KR+   PQVVLG  ++ G+ + + A        A+ L +  + W V 
Sbjct: 129 FGAVAVASLYPFMKRYTYYPQVVLGAAYSWGILMAFTAERGELPASAWLLFLANVLWTVA 188

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
           +D+ YA  D+++D  IG+ STA LF    +L
Sbjct: 189 YDSYYAMTDRENDLKIGIKSTAILFGDADRL 219


>gi|22124483|ref|NP_667906.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis KIM 10]
 gi|45440321|ref|NP_991860.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51594721|ref|YP_068912.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108809963|ref|YP_653879.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis Antiqua]
 gi|108813518|ref|YP_649285.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis Nepal516]
 gi|145600907|ref|YP_001164983.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis Pestoides
           F]
 gi|150260642|ref|ZP_01917370.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis CA88-4125]
 gi|162419104|ref|YP_001605259.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis Angola]
 gi|165926768|ref|ZP_02222600.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165936457|ref|ZP_02225025.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166010500|ref|ZP_02231398.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166213897|ref|ZP_02239932.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167402474|ref|ZP_02307931.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167418722|ref|ZP_02310475.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167426141|ref|ZP_02317894.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167467142|ref|ZP_02331846.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis FV-1]
 gi|170026076|ref|YP_001722581.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia
           pseudotuberculosis YPIII]
 gi|218927517|ref|YP_002345392.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis CO92]
 gi|229836568|ref|ZP_04456734.1| p-hydroxybenzoate octaprenyltransferase [Yersinia pestis Pestoides
           A]
 gi|229840176|ref|ZP_04460335.1| p-hydroxybenzoate octaprenyltransferase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229842258|ref|ZP_04462413.1| p-hydroxybenzoate octaprenyltransferase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229904004|ref|ZP_04519117.1| p-hydroxybenzoate octaprenyltransferase [Yersinia pestis Nepal516]
 gi|270489011|ref|ZP_06206085.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis KIM D27]
 gi|294502378|ref|YP_003566440.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis Z176003]
 gi|81640605|sp|Q66FH0|UBIA_YERPS RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|118574236|sp|Q1C0T8|UBIA_YERPA RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|118574237|sp|Q7CKP5|UBIA_YERPE RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|118574238|sp|Q1CE95|UBIA_YERPN RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|167011562|sp|A4TRU8|UBIA_YERPP RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790310|sp|A9QYL1|UBIA_YERPG RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|254790311|sp|B1JNE6|UBIA_YERPY RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|21957275|gb|AAM84157.1|AE013659_1 4-hydroxybenzoate-octaprenyltransferase [Yersinia pestis KIM 10]
 gi|45435177|gb|AAS60737.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51588003|emb|CAH19607.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108777166|gb|ABG19685.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis Nepal516]
 gi|108781876|gb|ABG15934.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis Antiqua]
 gi|115346128|emb|CAL18996.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis CO92]
 gi|145212603|gb|ABP42010.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis Pestoides
           F]
 gi|149290050|gb|EDM40127.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis CA88-4125]
 gi|162351919|gb|ABX85867.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis Angola]
 gi|165915573|gb|EDR34182.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921391|gb|EDR38615.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165990590|gb|EDR42891.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166204872|gb|EDR49352.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166962716|gb|EDR58737.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167048162|gb|EDR59570.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167054852|gb|EDR64654.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169752610|gb|ACA70128.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia
           pseudotuberculosis YPIII]
 gi|229679774|gb|EEO75877.1| p-hydroxybenzoate octaprenyltransferase [Yersinia pestis Nepal516]
 gi|229690568|gb|EEO82622.1| p-hydroxybenzoate octaprenyltransferase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229696542|gb|EEO86589.1| p-hydroxybenzoate octaprenyltransferase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229706252|gb|EEO92260.1| p-hydroxybenzoate octaprenyltransferase [Yersinia pestis Pestoides
           A]
 gi|262360461|gb|ACY57182.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis D106004]
 gi|262364407|gb|ACY60964.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis D182038]
 gi|270337515|gb|EFA48292.1| 4-hydroxybenzoate polyprenyl transferase [Yersinia pestis KIM D27]
 gi|294352837|gb|ADE63178.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia pestis Z176003]
 gi|320013825|gb|ADV97396.1| p-hydroxybenzoate octaprenyltransferase [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 288

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 94/285 (32%), Positives = 139/285 (48%), Gaps = 13/285 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  LA   +  A +L          ++++G    R A 
Sbjct: 13  YCRLMRIDKPIGSLLLLWPTLWALWLAGRGIPEAKIL---------VVFVLGVFFMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  ID  V RT SRPLPSG  +  ++ +  V+  L+SF L+L  N   I +  
Sbjct: 64  CVVNDYADRHIDGFVKRTASRPLPSGTISEKESKILFVVLILLSFGLVLTLNSMTIWLSL 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++ +YPF KR    PQVVLG  F   + +G+ A+  S     + L +  I W V +
Sbjct: 124 AALALAWIYPFMKRVTHLPQVVLGAAFGWSIPMGFAAVSESLPLVCWLLLLANICWTVAY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN--FFAWI 259
           DT YA  D+ DD  IGV STA LF    KL + +L    +L  +    L+ +   F+  I
Sbjct: 184 DTQYAMVDRDDDLRIGVKSTAILFGQHDKLIIGLLQLATLLLMVAIGWLMNLGGAFYWSI 243

Query: 260 GLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
            L  ALF   +++IA      + C   F +   VG+++ + ++IS
Sbjct: 244 LLAGALFTHQQKMIAQ--REREPCFRAFLNNNYVGLVLFLGILIS 286


>gi|295675572|ref|YP_003604096.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia sp.
           CCGE1002]
 gi|295435415|gb|ADG14585.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia sp.
           CCGE1002]
          Length = 287

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 87/160 (54%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L I+ +G ++ R A C  ND  D D D  V RT +RP+ SG+   ++A+V A +  LI+F
Sbjct: 44  LVIFTLGTVLMRSAGCAINDYADRDFDRHVKRTENRPITSGKINAWEAVVLATVLSLIAF 103

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+   N     +    LF++  YPF KRF   PQ  LGI F  G+ + + A+       
Sbjct: 104 LLIQPLNALTKELSVVALFVAGTYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDHVPLL 163

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFS 226
           A+ + +  IFW V +DT YA  D+ DD  IG+ ++A  F 
Sbjct: 164 AWVMLVANIFWAVAYDTEYAMVDRDDDIKIGIRTSALTFG 203


>gi|170732050|ref|YP_001763997.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia cenocepacia
           MC0-3]
 gi|254790261|sp|B1JVZ5|UBIA_BURCC RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|169815292|gb|ACA89875.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia cenocepacia
           MC0-3]
          Length = 287

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 102/202 (50%), Gaps = 12/202 (5%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L I+ +G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV    I+F
Sbjct: 44  LVIFTLGTLLMRSAGCAMNDYADRDFDRHVKRTADRPLTSGKIRAWEAVAIAVGLSFIAF 103

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+L  N     +    LF++  YPF KRF   PQ  LGI F  G+ + + A+  +    
Sbjct: 104 LLILPLNTLTKELSVVALFVAGSYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPML 163

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV 246
           A+ + +  IFW V +DT YA  D+ DD  IG+ ++A            + +G F +  ++
Sbjct: 164 AWVMLVANIFWSVAYDTEYAMVDRDDDIKIGIRTSA------------LTFGRFDVAAVM 211

Query: 247 AFCLLTVNFFAWIGLLIALFLT 268
           A    T+  + WIG+ +   L 
Sbjct: 212 ACYAATLGIYVWIGVTLGFGLA 233


>gi|107021805|ref|YP_620132.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia cenocepacia
           AU 1054]
 gi|116688752|ref|YP_834375.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia cenocepacia
           HI2424]
 gi|118574190|sp|Q1BYZ6|UBIA_BURCA RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|166988438|sp|A0K4Q5|UBIA_BURCH RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|105891994|gb|ABF75159.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia cenocepacia
           AU 1054]
 gi|116646841|gb|ABK07482.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia cenocepacia
           HI2424]
          Length = 287

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 102/202 (50%), Gaps = 12/202 (5%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L I+ +G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV    I+F
Sbjct: 44  LVIFTLGTLLMRSAGCAMNDYADRDFDRHVKRTADRPLTSGKIRAWEAVAIAVGLSFIAF 103

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+L  N     +    LF++  YPF KRF   PQ  LGI F  G+ + + A+  +    
Sbjct: 104 LLILPLNTLTKELSVVALFVAGSYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPML 163

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV 246
           A+ + +  IFW V +DT YA  D+ DD  IG+ ++A            + +G F +  ++
Sbjct: 164 AWVMLVANIFWSVAYDTEYAMVDRDDDIKIGIRTSA------------LTFGRFDVAAVM 211

Query: 247 AFCLLTVNFFAWIGLLIALFLT 268
           A    T+  + WIG+ +   L 
Sbjct: 212 ACYAATLGIYVWIGVTLGFGLA 233


>gi|30249792|ref|NP_841862.1| 4-hydroxybenzoate octaprenyltransferase [Nitrosomonas europaea ATCC
           19718]
 gi|30180829|emb|CAD85749.1| UbiA prenyltransferase [Nitrosomonas europaea ATCC 19718]
          Length = 297

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 90/289 (31%), Positives = 140/289 (48%), Gaps = 10/289 (3%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           ++ Y  L R     G  L + P LW   LAA  +    +L          I+I+G I+ R
Sbjct: 12  LSAYTRLIRLDKPIGILLLLWPTLWGLWLAADGMPDPMIL---------VIFILGTILMR 62

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
            A C  ND  D  ID  V RTR+RPL +G  T  +AL+ A    L +F+L+L  N   I 
Sbjct: 63  SAGCAINDFADRRIDPHVSRTRNRPLAAGLITAREALLIAAGLSLCAFLLILPLNLLTIQ 122

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +    LF++  YPF+KRF   PQ  LGI F+ G+ + + A   +    A+ L +  +FWV
Sbjct: 123 LSVPALFLAASYPFTKRFFAMPQAYLGIAFSFGIPMAFAAQTGTVPPLAWLLVLANLFWV 182

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT YA  D+ DD  IG+ ++A          + + + IF+     A  LL    + +
Sbjct: 183 IAYDTEYALVDRADDLKIGIRTSAITLGRFDVAGILLCHIIFLSTLTYAGILLQRGIWFY 242

Query: 259 IGLLIALFLTIKRIIALDISCSKQC-CSFFHSAGVVGILILICLIISLF 306
             LL+AL L I +   +      +C  +F H+  +  ++    L+ +LF
Sbjct: 243 GALLVALGLVIVQYGMIRKREPSRCFQAFLHNNWIGAVIFAGILLDTLF 291


>gi|255003319|ref|ZP_05278283.1| 4-hydroxybenzoate polyprenyltransferase [Anaplasma marginale str.
           Puerto Rico]
          Length = 299

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 80/219 (36%), Positives = 108/219 (49%), Gaps = 12/219 (5%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R  S     LA  P L S  +A+  + +          W   +  VGA + R A
Sbjct: 17  PYFTLCRLQSVEITLLAAFPALASISIASSSIAKT--------LWLFVLSAVGAAIVRTA 68

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP--FVIC 138
            C  ND+ D  ID++V RT++RPL SG  T  QAL   +L   I+  +LL  N   F + 
Sbjct: 69  GCVINDIFDRKIDAKVRRTKNRPLASGALTVPQALKVLLLLVGIALGILLLTNAMTFYLS 128

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
             FA+  +  LYP  KR+   PQ  LG  F  GV +G           +  L IG IFW 
Sbjct: 129 TFFAVGIV--LYPLMKRYFSYPQFFLGFVFNCGVLIGSAMAANKLVLGSILLYIGCIFWT 186

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY 237
             +DT+YA QDK+DD ++G+ STA  F   TK ++  LY
Sbjct: 187 TAYDTIYACQDKEDDAILGLGSTAVKFGANTKRYIGRLY 225


>gi|118574208|sp|Q82TP2|UBIA_NITEU RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
          Length = 292

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 90/289 (31%), Positives = 140/289 (48%), Gaps = 10/289 (3%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           ++ Y  L R     G  L + P LW   LAA  +    +L          I+I+G I+ R
Sbjct: 7   LSAYTRLIRLDKPIGILLLLWPTLWGLWLAADGMPDPMIL---------VIFILGTILMR 57

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
            A C  ND  D  ID  V RTR+RPL +G  T  +AL+ A    L +F+L+L  N   I 
Sbjct: 58  SAGCAINDFADRRIDPHVSRTRNRPLAAGLITAREALLIAAGLSLCAFLLILPLNLLTIQ 117

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
           +    LF++  YPF+KRF   PQ  LGI F+ G+ + + A   +    A+ L +  +FWV
Sbjct: 118 LSVPALFLAASYPFTKRFFAMPQAYLGIAFSFGIPMAFAAQTGTVPPLAWLLVLANLFWV 177

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAW 258
           + +DT YA  D+ DD  IG+ ++A          + + + IF+     A  LL    + +
Sbjct: 178 IAYDTEYALVDRADDLKIGIRTSAITLGRFDVAGILLCHIIFLSTLTYAGILLQRGIWFY 237

Query: 259 IGLLIALFLTIKRIIALDISCSKQC-CSFFHSAGVVGILILICLIISLF 306
             LL+AL L I +   +      +C  +F H+  +  ++    L+ +LF
Sbjct: 238 GALLVALGLVIVQYGMIRKREPSRCFQAFLHNNWIGAVIFAGILLDTLF 286


>gi|197336444|ref|YP_002157230.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio fischeri MJ11]
 gi|254790303|sp|B5FCB4|UBIA_VIBFM RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|197317934|gb|ACH67381.1| 4-hydroxybenzoate polyprenyl transferase [Vibrio fischeri MJ11]
          Length = 287

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 102/206 (49%), Gaps = 9/206 (4%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           L R +   G  L + P LW+  LAA      G+  W      L ++++G +  R A C  
Sbjct: 12  LTRMNRPIGSLLLLWPTLWALFLAA-----DGLPDWHV----LIVFVLGVVFMRSAGCVI 62

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALL 144
           ND  D  +D  V RT +RPLPSG  +  +AL F  +  + SF+L+L  N   I +    +
Sbjct: 63  NDFADRKVDGHVKRTANRPLPSGLISSKEALSFFAVLVVCSFLLVLTMNTLTIMLSSIGI 122

Query: 145 FISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTV 204
            +++ YPF KR    PQ VLG+ F+  + + + A        A+ L +    W + +DT 
Sbjct: 123 VLAIAYPFMKRVTYLPQFVLGLAFSWAIPMAYAAESNQVPSEAWLLFVINALWTIAYDTQ 182

Query: 205 YAHQDKKDDELIGVNSTARLFSYQTK 230
           YA  D+ DD  IG+ STA LF    K
Sbjct: 183 YAMVDRDDDVKIGIKSTAILFGRYDK 208


>gi|70994900|ref|XP_752227.1| para-hydroxybenzoate-polyprenyltransferase Coq2 [Aspergillus
           fumigatus Af293]
 gi|66849861|gb|EAL90189.1| para-hydroxybenzoate-polyprenyltransferase Coq2, putative
           [Aspergillus fumigatus Af293]
 gi|159124858|gb|EDP49975.1| para-hydroxybenzoate-polyprenyltransferase Coq2, putative
           [Aspergillus fumigatus A1163]
          Length = 419

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/230 (33%), Positives = 110/230 (47%), Gaps = 16/230 (6%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R    TG +    PC++ST++AA P+  A  +    I     ++  GA++ RGA
Sbjct: 116 PYAELIRLDKPTGTYYLFFPCVFSTLIAA-PMASATPM---QILGTTGLFFTGALIMRGA 171

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C  NDL D ++D  V RT+ RP+  G  +  +ALVF   Q L    +LLQF    +  G
Sbjct: 172 GCAINDLWDRNLDPYVERTKFRPIARGALSPKKALVFTCSQLLAGLAVLLQFPSQCLWYG 231

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF---------SWPAFFLC 191
              L +   YP +KR    PQ VLG+ F+ G  +G+ AL             +   +  C
Sbjct: 232 IPSLLLVTTYPLAKRVTYYPQAVLGLTFSWGAIMGFPALGVDLFSNHAALEAAAALYSSC 291

Query: 192 IGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFV 241
           +    W V +D +YAH D KDD   G+ S A    + TK  L  L  + V
Sbjct: 292 VA---WTVLYDMIYAHMDIKDDVAAGIKSIALRHEHNTKTVLSGLAAVQV 338


>gi|83721151|ref|YP_441833.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia thailandensis
           E264]
 gi|83654976|gb|ABC39039.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia
           thailandensis E264]
          Length = 310

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 63/177 (35%), Positives = 94/177 (53%), Gaps = 4/177 (2%)

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           I+++G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV   L+SF+L
Sbjct: 69  IFVLGTLLMRSAGCAINDYADRDFDRHVKRTAERPLTSGKIRAWEAVAIAVGLALVSFLL 128

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           +L  N     +    +F++  YPF KRF   PQ  LGI F  G+ + + A+  +    A+
Sbjct: 129 ILPLNALTKELSVVAVFVAATYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPALAW 188

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY----GIFV 241
            L    +FW V +DT YA  D+ DD  IG+ ++A  F     L + + Y    GI+V
Sbjct: 189 MLLAANVFWSVAYDTAYAMVDRDDDLKIGMRTSAITFGRYDVLAIMLCYAAMLGIYV 245


>gi|222475336|ref|YP_002563753.1| 4-hydroxybenzoate octaprenyltransferase (ubiA) [Anaplasma marginale
           str. Florida]
 gi|222419474|gb|ACM49497.1| 4-hydroxybenzoate octaprenyltransferase (ubiA) [Anaplasma marginale
           str. Florida]
          Length = 309

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 80/219 (36%), Positives = 108/219 (49%), Gaps = 12/219 (5%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R  S     LA  P L S  +A+  + +          W   +  VGA + R A
Sbjct: 27  PYFTLCRLQSVEITLLAAFPALASISIASSSIAKT--------LWLFVLSAVGAAIVRTA 78

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNP--FVIC 138
            C  ND+ D  ID++V RT++RPL SG  T  QAL   +L   I+  +LL  N   F + 
Sbjct: 79  GCVINDIFDRKIDAKVRRTKNRPLASGALTVPQALKVLLLLVGIALGILLLTNAMTFYLS 138

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWV 198
             FA+  +  LYP  KR+   PQ  LG  F  GV +G           +  L IG IFW 
Sbjct: 139 TFFAVGIV--LYPLMKRYFSYPQFFLGFVFNCGVLIGSAMAANKLVLGSILLYIGCIFWT 196

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY 237
             +DT+YA QDK+DD ++G+ STA  F   TK ++  LY
Sbjct: 197 TAYDTIYACQDKEDDAILGLGSTAVKFGANTKRYIGRLY 235


>gi|115350673|ref|YP_772512.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia ambifaria
           AMMD]
 gi|122323972|sp|Q0BI45|UBIA_BURCM RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|115280661|gb|ABI86178.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia ambifaria
           AMMD]
          Length = 290

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 87/160 (54%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L I+++G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV+   ISF
Sbjct: 44  LAIFVLGTLLMRSAGCAMNDYADRDFDRHVKRTADRPLTSGKIRAWEAVAIAVVLAFISF 103

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+   N     +    LF++  YPF KRF   PQ  LGI F  G+ + + A+  +    
Sbjct: 104 LLIQPLNTLTKELSVVALFVAGSYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPML 163

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFS 226
           A+ + I  IFW V +DT YA  D+ DD  IG+ ++A  F 
Sbjct: 164 AWVMLIANIFWSVAYDTEYAMVDRDDDIKIGIRTSALTFG 203


>gi|227113706|ref|ZP_03827362.1| 4-hydroxybenzoate octaprenyltransferase [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 287

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 86/284 (30%), Positives = 129/284 (45%), Gaps = 9/284 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  LA          G +   W LF+++ G  + R A 
Sbjct: 13  YCRLMRIDKPIGSLLLLWPTLWALWLAG---------GGAPAPWTLFVFVAGVFLMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D   D  V RT SRPLPSG+ +   A V  V+  L++F L+L  N   I +  
Sbjct: 64  CVINDYADRHFDGHVKRTASRPLPSGEVSERAAKVLFVVLVLLAFGLVLTLNKMTIWLSV 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++ +YPF KR    PQ VLG  F   + + + A+  S     + + +  I W V +
Sbjct: 124 AGLVLAWVYPFMKRVSHLPQFVLGAAFGWSIPMAYAAVSESLPASCWMMFVAYICWTVAY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DT YA  D+ DD  IGV STA LF     + + +L    +   ++   +  +    +I L
Sbjct: 184 DTQYAMVDRDDDLKIGVKSTAILFGRFDNIIIGLLQFSMLALLLILGKISGLGTPYYISL 243

Query: 262 LIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
           L+A  + + +           C   FH+    G+ I I ++  L
Sbjct: 244 LVAAGMFVYQQTLTAGRERDACFKAFHNNKYAGMAIFIGVLFGL 287


>gi|37528205|ref|NP_931550.1| 4-hydroxybenzoate octaprenyltransferase [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|81418186|sp|Q7MZB6|UBIA_PHOLL RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|36787642|emb|CAE16749.1| 4-hydroxybenzoate octaprenyltransferase (4-HB
           polyprenyltransferase) [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 288

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/210 (34%), Positives = 102/210 (48%), Gaps = 9/210 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R +   G  L + P  W+  +A   +    +L          ++  G  + R A 
Sbjct: 13  YCRLMRINKPIGALLLLWPTFWALWMAGKGIPDMHIL---------LVFTAGVFLMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D   D  V RT++RPLPSG  +  ++ +  V+  LISF L+L  N   I +  
Sbjct: 64  CAINDFADRKFDGYVERTKTRPLPSGAISEKESKILFVVLALISFGLVLTLNKMAIWLSA 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++ LYPF KRF   PQ VLG  +   + +G+ A+  S     + L +  IFW V +
Sbjct: 124 VGLALAWLYPFVKRFSHFPQFVLGAAYGWAIPMGFAAVSESLPLECWLLFLVNIFWSVIY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
           DT YA  D+ DD  IGV STA LF    KL
Sbjct: 184 DTQYAMVDRNDDLKIGVKSTAILFGRFDKL 213


>gi|241563438|ref|XP_002401704.1| para-hydroxybenzoate-polyprenyl transferase, putative [Ixodes
           scapularis]
 gi|215501896|gb|EEC11390.1| para-hydroxybenzoate-polyprenyl transferase, putative [Ixodes
           scapularis]
          Length = 227

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/223 (32%), Positives = 111/223 (49%), Gaps = 2/223 (0%)

Query: 76  VTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPF 135
           +TR + C  ND+ D   D  V RT+ RPL S   +   A+    +  +IS  +LL  N  
Sbjct: 1   MTRSSGCIINDIFDRKFDKHVARTKDRPLASKALSVSYAIFILFILSVISLCILLLLNKT 60

Query: 136 VICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTI 195
            I  GF  + +  LYP  KR    PQ+ LG  F  G  + + A+       A  + I   
Sbjct: 61  AIYTGFFAVIMISLYPLMKRITYFPQIFLGFSFKLGALIAYAAVQDKLDMAAIIMYIACC 120

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNS-TARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVN 254
           FW + +DT+Y + D KDD+ IGV S +  L +   KLWL+I Y   +L F++A  +   N
Sbjct: 121 FWAIGYDTIYGYMDIKDDKKIGVKSLSVYLENKHPKLWLYICYIGCILLFILATKMANHN 180

Query: 255 FFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
              ++ +L AL + I ++  LDI     C + F +   VG+L+
Sbjct: 181 -IDYLPILAALIILILQVATLDIENPTDCMTRFRANNYVGVLL 222


>gi|323498068|ref|ZP_08103074.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio sinaloensis DSM
           21326]
 gi|323316876|gb|EGA69881.1| 4-hydroxybenzoate octaprenyltransferase [Vibrio sinaloensis DSM
           21326]
          Length = 284

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 88/165 (53%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L ++I+G +  R A C  ND  D  +D  V RT  RPLPSG+ +  +A+   ++  + SF
Sbjct: 45  LVVFILGVVFMRAAGCVINDFADRKVDGHVKRTSQRPLPSGRVSSKEAISLFLILAVASF 104

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+L  N   I + F  + ++ +YPF KRF   PQ+ LG+ F+  + + W A        
Sbjct: 105 LLVLSMNTLTITLSFVGIVLAFIYPFMKRFTHLPQLFLGLAFSWSIPMAWAAQANELPLV 164

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKL 231
            +FL      W + +DT YA  D+ DD  IG+ STA LF    K+
Sbjct: 165 VWFLFAVNALWTIAYDTQYAMVDRDDDLKIGIKSTAILFGRFDKM 209


>gi|212710568|ref|ZP_03318696.1| hypothetical protein PROVALCAL_01631 [Providencia alcalifaciens DSM
           30120]
 gi|212686805|gb|EEB46333.1| hypothetical protein PROVALCAL_01631 [Providencia alcalifaciens DSM
           30120]
          Length = 284

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 114/240 (47%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L ++  G    R A C  ND  D   D  V RT+ RPLPSG  T  +A +       +SF
Sbjct: 45  LIVFTAGVFFMRAAGCVINDFADRHFDGHVERTKHRPLPSGDVTEKEAKILFAALVGLSF 104

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+L  N   I +  A L ++ +YPF KR    PQVVLG  F   + +G+ A+  S    
Sbjct: 105 LLVLTLNTMTIWLSVAGLALAWIYPFVKRVSHLPQVVLGAAFGWSIPMGFSAVSESLPLV 164

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV 246
            + L +  I W V +DT YA  D+ DD  IGV STA LF    K  + +L  + +   +V
Sbjct: 165 CWLLFLVNIIWSVIYDTQYAMVDRNDDLKIGVKSTAILFGQYDKRIIGLLQVVMIGLLVV 224

Query: 247 AFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLF 306
              L  +    +  L++A  L + +   +       C   F +   VG+++   +++S F
Sbjct: 225 IGVLANLGLVYYGSLVLAAALFVYQQQLMINRERAPCFKAFMNNNYVGLILFFGMVVSYF 284


>gi|312795170|ref|YP_004028092.1| 4-hydroxybenzoate polyprenyltransferase [Burkholderia rhizoxinica
           HKI 454]
 gi|312166945|emb|CBW73948.1| 4-hydroxybenzoate polyprenyltransferase (EC 2.5.1.-) [Burkholderia
           rhizoxinica HKI 454]
          Length = 299

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 125/254 (49%), Gaps = 27/254 (10%)

Query: 12  DCIMGSAIA---P-YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYL 67
           +C M SA+    P Y  L R H   G  L + P L +  +AA     A ++         
Sbjct: 6   ECCMMSALTLRLPLYFRLLRLHKPIGSVLLLWPTLNALWIAADGHPPAHIVA-------- 57

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
            I+ +G ++ R A C  ND  D D D  V RT+ RPL SGQ   ++AL  A    L+SF+
Sbjct: 58  -IFAIGTVLMRSAGCAINDYADRDFDKHVKRTQDRPLTSGQIAPWKALAVAAALALVSFL 116

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA 187
           L+L  N     +  A LF++  YPF KRF   PQ  LGI F  G+ +G+ A+       A
Sbjct: 117 LILPLNALTKWLSVAALFVAGTYPFMKRFFAIPQAYLGIAFGFGIPMGFAAIQDQVPPLA 176

Query: 188 FFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIF-VLCFMV 246
           + + +  +FW V +DT YA  D+ DD  IG+ ++A            + +G F VL  M+
Sbjct: 177 WLMLLANVFWSVAYDTAYAMVDRDDDIKIGIRTSA------------LTFGRFDVLAVML 224

Query: 247 AFCLLTVNFFAWIG 260
            +  + +  +AWIG
Sbjct: 225 CYAAM-LGIYAWIG 237


>gi|90407072|ref|ZP_01215261.1| 4-hydroxybenzoate polyprenyltransferase [Psychromonas sp. CNPT3]
 gi|90311794|gb|EAS39890.1| 4-hydroxybenzoate polyprenyltransferase [Psychromonas sp. CNPT3]
          Length = 288

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 104/205 (50%), Gaps = 9/205 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L R +   G  L + P LW+  +AA  +    VL          ++  G  + R   
Sbjct: 13  YLELMRLNKPIGSLLLLWPTLWALWIAAEGIPDLSVL---------LVFSCGVFLMRSTG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  ID  V RT++RPLPSG+ +  +AL    +  L +F+L+L  N   I +  
Sbjct: 64  CVINDFADRKIDGFVERTKNRPLPSGRVSPKEALFLFFMLTLSAFLLVLTQNTLTIQLSV 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++ LYPFSKR    PQ VLG+ F+  + + + A         + L +  + W + +
Sbjct: 124 VGLLLASLYPFSKRVTHLPQFVLGLAFSWSIPMAYAAQSGRLDSIVWLLFVINVIWTIAY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFS 226
           DT+YA  DK+DD  IGV S+A LFS
Sbjct: 184 DTLYAMVDKEDDLKIGVKSSAILFS 208


>gi|85060121|ref|YP_455823.1| 4-hydroxybenzoate octaprenyltransferase [Sodalis glossinidius str.
           'morsitans']
 gi|118574230|sp|Q2NR07|UBIA_SODGM RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|84780641|dbj|BAE75418.1| 4-hydroxybenzoate octaprenyltransferase [Sodalis glossinidius str.
           'morsitans']
          Length = 290

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 138/286 (48%), Gaps = 17/286 (5%)

Query: 25  LARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTW 84
           L R     G  L + P LW+  LA   +   G L          ++I+G    R A C  
Sbjct: 16  LMRIDKPIGSLLLLWPTLWALWLAGMAIPALGTL---------TVFILGVFFMRAAGCVI 66

Query: 85  NDLVDHDIDSQVLRTRSRPLPSGQCTRFQA-LVFAVLQFLISFVLLLQFNPFVICVGFAL 143
           ND  D  ID  V RTR+RPLPSG     +A L+F  L   ISF L+L  N   I +    
Sbjct: 67  NDYADRKIDGHVKRTRARPLPSGAIGEKEAKLLFGAL-VGISFALVLTLNSMTIALSTVA 125

Query: 144 LFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDT 203
           L ++ +YPF KR+   PQ+VLG  F   + + + A+  S     + L +  I W V +DT
Sbjct: 126 LALAWVYPFMKRYTHLPQLVLGAAFGWSIPMVFTAVSESLPLSCWLLFLANITWTVAYDT 185

Query: 204 VYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLI 263
            YA  D+ DD  IGV STA LF    KL + +L    +L   V    L +    ++ L  
Sbjct: 186 QYAMVDRDDDLRIGVKSTAILFGRFDKLIIGLLQLATLLLLGVIGWQLGLGRIYYLALAG 245

Query: 264 A--LFLTIKRIIALDISCSKQCC-SFFHSAGVVGILILICLIISLF 306
           A  LFL  +++I   +   ++ C   F +  +VG+LI + +++SL 
Sbjct: 246 AAGLFLWQQKLI---VDREREACFRAFLNNNLVGMLIFVGILLSLL 288


>gi|261249997|ref|ZP_05942574.1| 4-hydroxybenzoate polyprenyltransferase [Vibrio orientalis CIP
           102891]
 gi|260939501|gb|EEX95486.1| 4-hydroxybenzoate polyprenyltransferase [Vibrio orientalis CIP
           102891]
          Length = 284

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 123/243 (50%), Gaps = 4/243 (1%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
           F  L ++++G I  R A C  ND  D  +D  V RT+ RPLPSG+ +  +A+   +   +
Sbjct: 42  FKVLLVFVLGVIFMRAAGCVINDFADRKVDGHVKRTKQRPLPSGRVSSKEAIGLFLALAI 101

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
            SFVL+L  N   I +    + ++ +YPF KRF   PQ+ LG+ F+  + + W A     
Sbjct: 102 SSFVLVLSMNTLTIQLSIVGIVLAFIYPFMKRFTHLPQLFLGLAFSWSIPMAWAAQSGEV 161

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY--GIFV 241
               +F+      W + +DT YA  D+ DD  IG+ STA LF    K+ + +L    + +
Sbjct: 162 PMMVWFIFAINAIWTIAYDTQYAMVDRDDDLKIGIKSTAILFGRFDKMVIGVLQLMTLTM 221

Query: 242 LCFMVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICL 301
           L F+  +  L  +F+  + ++ ALF+  + +I         C   F +   VG+++ I L
Sbjct: 222 LMFVGTWYQLGASFYWSLLMVGALFVFQQHLIRH--RERDLCFRAFLNNNYVGMIVTIGL 279

Query: 302 IIS 304
            I+
Sbjct: 280 FIA 282


>gi|114328852|ref|YP_746010.1| 4-hydroxybenzoate polyprenyltransferase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317026|gb|ABI63086.1| 4-hydroxybenzoate polyprenyltransferase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 322

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 90/282 (31%), Positives = 135/282 (47%), Gaps = 11/282 (3%)

Query: 19  IAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTR 78
           I PY  LAR     G  L  LP +W  +LAA P  R  +         + ++++G+ V R
Sbjct: 36  IQPYALLARLDRPVGIWLLFLPGVWG-ILAARPPDRESLR-------LIVMFLIGSAVMR 87

Query: 79  GAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVIC 138
            A C  ND+ D D+D  V RT SRPL +G     QA VF  L  L  F++LLQ       
Sbjct: 88  SAGCVVNDMWDRDLDRSVARTASRPLAAGVLGMRQATVFLGLLLLAGFMVLLQLPRMAQI 147

Query: 139 VGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFS---WPAFFLCIGTI 195
              + L +  +YP +KR    PQ+V+G  F  G   G  A  A      W   FL    I
Sbjct: 148 AAASSLLLVAIYPLAKRVTWWPQLVMGFTFGFGAPAGAIAAGAETGPHWWLVGFLYAAAI 207

Query: 196 FWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNF 255
           FW + FDT+Y  QD +DD +IGV ST+R F++  + ++   Y + V+  ++A     + +
Sbjct: 208 FWDLGFDTIYGFQDIEDDAVIGVKSTSRRFAHMPRRFVGTSYALMVVFLILAGIRAGLPW 267

Query: 256 FAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
              + L +   L + ++  LDI     C   F +   +G+ +
Sbjct: 268 LYDLALTLPAALLLWQVHRLDILNPAACLGAFRANTRIGLAV 309


>gi|325526993|gb|EGD04438.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia sp. TJI49]
          Length = 274

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/196 (32%), Positives = 101/196 (51%), Gaps = 12/196 (6%)

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           I+ +G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV    ++F+L
Sbjct: 33  IFALGTLLMRSAGCAMNDYADRDFDRHVKRTADRPLTSGKIHAWEAVAIAVGLSFLAFLL 92

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           +L  N     +    LF++  YPF KRF   PQ  LGI F  G+ + + A+  +    A+
Sbjct: 93  ILPLNTLTKQLSVVALFVAGTYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPAIAW 152

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAF 248
            + I  +FW V +DT YA  D+ DD  IG+ ++A            + +G F +  ++A 
Sbjct: 153 VMLIANVFWSVAYDTEYAMVDRDDDIKIGIRTSA------------LTFGRFDVAAVMAC 200

Query: 249 CLLTVNFFAWIGLLIA 264
             +T+  + WIGL + 
Sbjct: 201 YAVTLGIYVWIGLTLG 216


>gi|78065291|ref|YP_368060.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia sp. 383]
 gi|118574194|sp|Q39JF0|UBIA_BURS3 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|77966036|gb|ABB07416.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia sp. 383]
          Length = 287

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 103/202 (50%), Gaps = 12/202 (5%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L I+ +G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV    +SF
Sbjct: 44  LVIFSLGTLLMRSAGCAMNDYADRDFDRHVKRTADRPLTSGKIRAWEAIAIAVGLAFVSF 103

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+L  N     +    LF++  YPF KRF   PQ  LGI F  G+ + + A+  +    
Sbjct: 104 LLILPLNTLTKQLSVVALFVAGSYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPTI 163

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV 246
           A+ + I  IFW V +DT YA  D+ DD  IG+ ++A  F        F +  + +LC+ V
Sbjct: 164 AWVMLIANIFWSVAYDTEYAMVDRDDDIKIGIRTSALTFGR------FDVAAV-MLCYAV 216

Query: 247 AFCLLTVNFFAWIGLLIALFLT 268
                T+  + WIG+ +   L 
Sbjct: 217 -----TLGIYVWIGVTLGFGLA 233


>gi|212528700|ref|XP_002144507.1| para-hydroxybenzoate-polyprenyltransferase Coq2, putative
           [Penicillium marneffei ATCC 18224]
 gi|210073905|gb|EEA27992.1| para-hydroxybenzoate-polyprenyltransferase Coq2, putative
           [Penicillium marneffei ATCC 18224]
          Length = 428

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 104/216 (48%), Gaps = 8/216 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R    TG +    PCL+ST+LAA     A +     I  Y  ++  GA++ RGA
Sbjct: 116 PYAELIRLDKPTGTYYLFFPCLFSTLLAA--PLAAPMASPPEILAYSGLFFSGALIMRGA 173

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL D D D  V RTR RP+  G  T  +A+VF   Q L    +LLQF    +  G
Sbjct: 174 GCTINDLWDKDFDPHVTRTRFRPIARGAVTPEKAIVFTGFQLLAGLGILLQFPLQCLYYG 233

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGAL------HASFSWPAFFLCIGT 194
              L     YP +KR    PQ VLG+ F+ G  +G+ AL      +      A  L    
Sbjct: 234 VPSLVFVATYPLAKRVTNYPQAVLGLTFSWGAVMGFPALGVDILSNTDALLSAAALYSSC 293

Query: 195 IFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
           + W V +D +YAH D KDD   G+ S A    + TK
Sbjct: 294 VAWTVLYDMIYAHMDIKDDAAAGIKSIALRHEHNTK 329


>gi|238752160|ref|ZP_04613642.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia rohdei ATCC
           43380]
 gi|238709633|gb|EEQ01869.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia rohdei ATCC
           43380]
          Length = 296

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 92/285 (32%), Positives = 137/285 (48%), Gaps = 13/285 (4%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  LA   +    +L          ++++G    R A 
Sbjct: 18  YCRLMRIDKPIGSLLLLWPTLWALWLAGQGVPDTRIL---------IVFVLGVFFMRAAG 68

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  ID  V RT SRPLPSG  +  ++ +  V+  L+SF L+L  N   I +  
Sbjct: 69  CVVNDYADRHIDGFVKRTSSRPLPSGLISEKESKILFVVLVLLSFGLVLTLNSMTIWLSL 128

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
           A L ++ +YPF KR    PQVVLG  F   + +G+ A+  S     + L +  I W V +
Sbjct: 129 AALALAWIYPFMKRVTHLPQVVLGAAFGWSIPMGFAAVSESLPLVCWLLLLANICWTVAY 188

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFMVAFCLLTVNFFAWIG 260
           DT YA  D+ DD  IGV STA LF    KL + +L     +L   + + +     F W  
Sbjct: 189 DTQYAMVDRDDDLKIGVKSTAILFGRHDKLVIGLLQLATLILMVAIGWLMNLGGAFYWSV 248

Query: 261 LLI-ALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           LL  ALF+  +++IA        C   F +   VG+++ + +++S
Sbjct: 249 LLAGALFIHQQKMIAQ--RERALCFRAFLNNNYVGLVLFLGILLS 291


>gi|157828903|ref|YP_001495145.1| 4-hydroxybenzoate polyprenyltransferase [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165933627|ref|YP_001650416.1| 4-hydroxybenzoate polyprenyltransferase [Rickettsia rickettsii str.
           Iowa]
 gi|157801384|gb|ABV76637.1| prenyltransferase [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165908714|gb|ABY73010.1| 4-hydroxybenzoate polyprenyltransferase [Rickettsia rickettsii str.
           Iowa]
          Length = 302

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 83/272 (30%), Positives = 135/272 (49%), Gaps = 10/272 (3%)

Query: 27  RWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWND 86
           R      + L   P L+  +LA  P R       + +   L ++I+G+I  R + C  ND
Sbjct: 35  RADKLVAYWLVFFPALFGLLLAN-PSR-------TELIHLLPLFILGSITARSSGCIIND 86

Query: 87  LVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFI 146
           + D   D  V RT+ RPL S   +   A++   +  +IS  +LL  N   I +GF  + +
Sbjct: 87  IFDRKFDKHVARTKERPLASKALSVSYAILILFILSIISLCILLLLNKTAIYIGFLAVIM 146

Query: 147 SLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYA 206
             LYP  KR    PQ+ LG  F  G  + + A+  +    A  + +   FW + +DT+Y 
Sbjct: 147 ISLYPLMKRITYFPQIFLGFTFKLGALIAYAAVQDTLDIAAIIMYLACCFWAIGYDTIYG 206

Query: 207 HQDKKDDELIGVNS-TARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIAL 265
           + D KDD+ IGV S +  L +  +KLWL+I Y  F+L F++A  +   N   ++ +L AL
Sbjct: 207 YMDIKDDKKIGVKSLSIYLENKHSKLWLYICYIGFILLFILATKMANHN-IDYLPILAAL 265

Query: 266 FLTIKRIIALDISCSKQCCSFFHSAGVVGILI 297
            L I ++  LDI     C + F +   +G+++
Sbjct: 266 ILLILQVATLDIENPANCMTRFRANNYIGLVL 297


>gi|221202251|ref|ZP_03575285.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia multivorans
           CGD2M]
 gi|221209160|ref|ZP_03582153.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia multivorans
           CGD2]
 gi|221170978|gb|EEE03432.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia multivorans
           CGD2]
 gi|221177825|gb|EEE10238.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia multivorans
           CGD2M]
          Length = 301

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 101/196 (51%), Gaps = 12/196 (6%)

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           I+ +G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV    ++F+L
Sbjct: 60  IFALGTLLMRSAGCAMNDYADRDFDRHVKRTADRPLTSGKIRAWEAVAIAVGLSFVAFLL 119

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           +L  N     +    LF++  YPF KRF   PQ  LGI F  G+ + + A+  +    A+
Sbjct: 120 ILPLNTLTKELSVVALFVAGTYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQNTVPPLAW 179

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAF 248
            + I  +FW V +DT YA  D+ DD  IG+ ++A            + +G F +  ++A 
Sbjct: 180 VMLIANVFWSVAYDTEYAMVDRDDDIKIGIRTSA------------LTFGRFDVAAVMAC 227

Query: 249 CLLTVNFFAWIGLLIA 264
             +T+  + WIG+ + 
Sbjct: 228 YAVTLGIYVWIGITLG 243


>gi|134294802|ref|YP_001118537.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia vietnamiensis
           G4]
 gi|166988442|sp|A4JBP9|UBIA_BURVG RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|134137959|gb|ABO53702.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia vietnamiensis
           G4]
          Length = 290

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 100/192 (52%), Gaps = 12/192 (6%)

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           I+ +G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  A +   ++F+L
Sbjct: 46  IFALGTLLMRSAGCAMNDYADRDFDRHVKRTADRPLTSGKIRAWEAVAIAAVLSFVAFLL 105

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           +L  N     +    LF++  YPF KRF   PQ  LGI F  G+ + + A+  +    A+
Sbjct: 106 ILPLNTLTKELSVVALFVAGSYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQGTVPALAW 165

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAF 248
            + +  +FW V +DT YA  D+ DD  IG+ ++A  F        F +  I +LC+ V  
Sbjct: 166 VMLVANVFWSVAYDTEYAMVDRDDDIKIGIRTSALTFGR------FDVAAI-MLCYAV-- 216

Query: 249 CLLTVNFFAWIG 260
              T+  +AWIG
Sbjct: 217 ---TLGIYAWIG 225


>gi|126439386|ref|YP_001060327.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia pseudomallei
           668]
 gi|126452568|ref|YP_001067587.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia pseudomallei
           1106a]
 gi|134280604|ref|ZP_01767315.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           305]
 gi|167721127|ref|ZP_02404363.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia pseudomallei
           DM98]
 gi|167904178|ref|ZP_02491383.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia pseudomallei
           NCTC 13177]
 gi|242317187|ref|ZP_04816203.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           1106b]
 gi|254180728|ref|ZP_04887326.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           1655]
 gi|166988440|sp|A3NZ16|UBIA_BURP0 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|166988441|sp|A3NDA6|UBIA_BURP6 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|126218879|gb|ABN82385.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           668]
 gi|126226210|gb|ABN89750.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           1106a]
 gi|134248611|gb|EBA48694.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           305]
 gi|184211267|gb|EDU08310.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           1655]
 gi|242140426|gb|EES26828.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           1106b]
          Length = 287

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 93/177 (52%), Gaps = 4/177 (2%)

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           I+ +G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV   L+SF+L
Sbjct: 46  IFALGTLLMRSAGCAINDYADRDFDRHVKRTAERPLTSGKIRAWEAIAIAVGLALVSFLL 105

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           +L  N     +    +F++  YPF KRF   PQ  LGI F  G+ + + A+  +    A+
Sbjct: 106 ILPLNGLTKELSVVAVFVAATYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPMIAW 165

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY----GIFV 241
            +    +FW V +DT YA  D+ DD  IG+ ++A  F     L + + Y    GI+V
Sbjct: 166 AMLAANVFWSVAYDTAYAMVDRDDDLKIGMRTSAITFGRHDVLAIMLCYAAMLGIYV 222


>gi|167895791|ref|ZP_02483193.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia pseudomallei
           7894]
 gi|167920392|ref|ZP_02507483.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia pseudomallei
           BCC215]
          Length = 287

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 93/177 (52%), Gaps = 4/177 (2%)

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           I+ +G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV   L+SF+L
Sbjct: 46  IFALGTLLMRSAGCAINDYADRDFDRHVKRTAERPLTSGKIRAWEAIAIAVGLALVSFLL 105

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           +L  N     +    +F++  YPF KRF   PQ  LGI F  G+ + + A+  +    A+
Sbjct: 106 ILPLNGLTKELSVVAVFVAATYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPMIAW 165

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY----GIFV 241
            +    +FW V +DT YA  D+ DD  IG+ ++A  F     L + + Y    GI+V
Sbjct: 166 AMLAANVFWSVAYDTAYAMVDRDDDLKIGMRTSAITFGRHDVLAIMLCYAAMLGIYV 222


>gi|126451268|ref|YP_001082108.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia mallei NCTC
           10247]
 gi|167004250|ref|ZP_02270013.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia mallei
           PRL-20]
 gi|167740096|ref|ZP_02412870.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia pseudomallei
           14]
 gi|167817308|ref|ZP_02448988.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia pseudomallei
           91]
 gi|167825719|ref|ZP_02457190.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia pseudomallei
           9]
 gi|167847204|ref|ZP_02472712.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia pseudomallei
           B7210]
 gi|167912437|ref|ZP_02499528.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia pseudomallei
           112]
 gi|217420969|ref|ZP_03452474.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           576]
 gi|226198385|ref|ZP_03793954.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           Pakistan 9]
 gi|238562016|ref|ZP_00441112.2| 4-hydroxybenzoate polyprenyl transferase [Burkholderia mallei GB8
           horse 4]
 gi|254178976|ref|ZP_04885630.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia mallei ATCC
           10399]
 gi|254191561|ref|ZP_04898064.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254194853|ref|ZP_04901283.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           S13]
 gi|254202667|ref|ZP_04909030.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia mallei FMH]
 gi|254208006|ref|ZP_04914356.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia mallei JHU]
 gi|254260860|ref|ZP_04951914.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           1710a]
 gi|254299184|ref|ZP_04966634.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           406e]
 gi|254355853|ref|ZP_04972131.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia mallei
           2002721280]
 gi|118574191|sp|Q62H69|UBIA_BURMA RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|118574192|sp|Q3JNX1|UBIA_BURP1 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|118574193|sp|Q63R13|UBIA_BURPS RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|166988439|sp|A3MPC2|UBIA_BURM7 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|126244138|gb|ABO07231.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia mallei NCTC
           10247]
 gi|147746914|gb|EDK53991.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia mallei FMH]
 gi|147751900|gb|EDK58967.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia mallei JHU]
 gi|148024828|gb|EDK83006.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia mallei
           2002721280]
 gi|157808792|gb|EDO85962.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           406e]
 gi|157939232|gb|EDO94902.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160694890|gb|EDP84898.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia mallei ATCC
           10399]
 gi|169651602|gb|EDS84295.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           S13]
 gi|217396381|gb|EEC36398.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           576]
 gi|225929568|gb|EEH25586.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           Pakistan 9]
 gi|238523494|gb|EEP86932.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia mallei GB8
           horse 4]
 gi|243060387|gb|EES42573.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia mallei
           PRL-20]
 gi|254219549|gb|EET08933.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           1710a]
          Length = 287

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 93/177 (52%), Gaps = 4/177 (2%)

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           I+ +G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV   L+SF+L
Sbjct: 46  IFALGTLLMRSAGCAINDYADRDFDRHVKRTAERPLTSGKIRAWEAIAIAVGLALVSFLL 105

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           +L  N     +    +F++  YPF KRF   PQ  LGI F  G+ + + A+  +    A+
Sbjct: 106 ILPLNGLTKELSVVAVFVAATYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPMIAW 165

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY----GIFV 241
            +    +FW V +DT YA  D+ DD  IG+ ++A  F     L + + Y    GI+V
Sbjct: 166 AMLAANVFWSVAYDTAYAMVDRDDDLKIGMRTSAITFGRHDVLAIMLCYAAMLGIYV 222


>gi|238789917|ref|ZP_04633697.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia frederiksenii
           ATCC 33641]
 gi|238721990|gb|EEQ13650.1| 4-hydroxybenzoate octaprenyltransferase [Yersinia frederiksenii
           ATCC 33641]
          Length = 272

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 135/280 (48%), Gaps = 13/280 (4%)

Query: 27  RWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWND 86
           R     G  L + P LW+  LA   +    +L          ++++G    R A C  ND
Sbjct: 2   RIDKPIGSLLLLWPTLWALWLAGQGIPETKIL---------IVFVLGVFFMRAAGCVVND 52

Query: 87  LVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFI 146
             D  ID  V RT SRPLPSG  +  ++ +  V+  L+SF L+L  N   I +  A L +
Sbjct: 53  YADRHIDGFVKRTASRPLPSGLISEKESKILFVVLVLLSFGLVLTLNSMTIWLSLAALAL 112

Query: 147 SLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYA 206
           + +YPF KR    PQVVLG  F   + +G+ A+  S     + L +  I W V +DT YA
Sbjct: 113 AWVYPFMKRVTHLPQVVLGAAFGWSIPMGFAAVSESLPLACWLLLLANICWTVAYDTQYA 172

Query: 207 HQDKKDDELIGVNSTARLFSYQTKLWLFILY-GIFVLCFMVAFCLLTVNFFAWIGLLI-A 264
             D+ DD  IGV STA LF    KL + +L     VL   + + +     F W  LL  A
Sbjct: 173 MVDRDDDLKIGVKSTAILFGQYDKLIIGLLQLATLVLMVAIGWLMNLGGAFYWSVLLAGA 232

Query: 265 LFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           LF+  +++IA        C   F +   VG+++ + +++S
Sbjct: 233 LFVHQQKMIAQ--RERDPCFRAFLNNNYVGLVLFLGILVS 270


>gi|237813715|ref|YP_002898166.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           MSHR346]
 gi|237505127|gb|ACQ97445.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia pseudomallei
           MSHR346]
          Length = 287

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 93/177 (52%), Gaps = 4/177 (2%)

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           I+ +G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV   L+SF+L
Sbjct: 46  IFALGTLLMRSAGCAINDYADRDFDRHVKRTAERPLTSGKIRAWEAIAIAVGLALVSFLL 105

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           +L  N     +    +F++  YPF KRF   PQ  LGI F  G+ + + A+  +    A+
Sbjct: 106 ILPLNGLTKELSVVAVFVAATYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPMIAW 165

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILY----GIFV 241
            +    +FW V +DT YA  D+ DD  IG+ ++A  F     L + + Y    GI+V
Sbjct: 166 AMLAANVFWSVAYDTAYAMVDRDDDLKIGMRTSAITFGRHDVLAIMLCYAAMLGIYV 222


>gi|189037060|sp|A4STB5|UBIA_AERS4 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
          Length = 289

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 81/247 (32%), Positives = 129/247 (52%), Gaps = 6/247 (2%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQAL-VFAVLQF 122
            W L +++VG  + R A C  ND  D + D  V RT  RPLP G+    + L +FAVL  
Sbjct: 45  LWTLLVFVVGVFLMRSAGCVINDYADRNFDGHVKRTAGRPLPMGKVKPREVLALFAVLA- 103

Query: 123 LISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHAS 182
           LISF L+L  N   I + FA L +++ YPF KR+I  PQ+VLG+ F+  + + + A   +
Sbjct: 104 LISFALVLTMNSLTIALSFAALLLAVCYPFMKRYIPIPQLVLGMAFSWSIPMAYAAQANA 163

Query: 183 FSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVL 242
               A+ + +  + W + +DT YA  D+ DD  +G+ S+A LF    K  + +L    +L
Sbjct: 164 LPLVAWLVFLANLLWTIAYDTQYAMVDRDDDLKLGLKSSAILFGRHDKRIIGVLQLATLL 223

Query: 243 CFMVAFCLLTVNFFAWIGLL--IALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILIC 300
             +    L+ +  + + GLL   ALF+  +R+I       + C   F +    G L+ I 
Sbjct: 224 ILLAVGQLMGLGAWYYWGLLGAAALFVYQQRLI--RERQREACFQAFLNNNYAGALVFIG 281

Query: 301 LIISLFL 307
           L+++  L
Sbjct: 282 LVLNYLL 288


>gi|89902440|ref|YP_524911.1| 4-hydroxybenzoate polyprenyl transferase [Rhodoferax ferrireducens
           T118]
 gi|118574221|sp|Q21S73|UBIA_RHOFD RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|89347177|gb|ABD71380.1| 4-hydroxybenzoate octaprenyltransferase [Rhodoferax ferrireducens
           T118]
          Length = 296

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 114/206 (55%), Gaps = 9/206 (4%)

Query: 17  SAIAPYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIV 76
           S +A Y+ L RW+   GW L + P L +  +AA      G  GW      L ++ +G I+
Sbjct: 14  SRLALYLDLIRWNRPAGWLLLLWPTLSALWVAA-----GGFPGWH----LLSVFTLGTIL 64

Query: 77  TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFV 136
            R A C  ND+ D D D  V RT +RP+ +G  +  +ALV   +  L++F L+L  N   
Sbjct: 65  MRSAGCCINDVADRDFDRHVKRTAARPVTTGAVSVKEALVLGAVLALLAFALVLTTNAIT 124

Query: 137 ICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIF 196
           I +  A L I+L YP++KR++  PQ VLG+ F  G+ + + A+       A+ L +G +F
Sbjct: 125 IGISGAALAITLAYPYAKRYVSMPQAVLGVAFGMGIPMAFAAVLGEVPRLAWLLMLGNLF 184

Query: 197 WVVYFDTVYAHQDKKDDELIGVNSTA 222
           WV+ +DT YA  D+ DD  +G+ ++A
Sbjct: 185 WVLAYDTEYAMVDRDDDIRLGLKTSA 210


>gi|157960298|ref|YP_001500332.1| 4-hydroxybenzoate octaprenyltransferase [Shewanella pealeana ATCC
           700345]
 gi|189037004|sp|A8GZR0|UBIA_SHEPA RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|157845298|gb|ABV85797.1| 4-hydroxybenzoate polyprenyl transferase [Shewanella pealeana ATCC
           700345]
          Length = 288

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 70/226 (30%), Positives = 114/226 (50%), Gaps = 9/226 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ LAR     G  L + PCL +   AA  L    V           I+++G    R   
Sbjct: 10  YMRLARMDRPIGTLLLLWPCLMALTFAAGGLPDLKVF---------IIFVIGVFSMRACG 60

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D  +D+ V RT+ RPL SG+ +  +AL+  V+  L SF L+L  NP V+ +  
Sbjct: 61  CIINDYADRKLDAHVERTKGRPLASGEVSSKEALLLFVVMALFSFGLVLMLNPLVVQLSV 120

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + ++++YPF+KR+   PQ+ LG  ++  + + + A   +    A++L      W V +
Sbjct: 121 IGIILTIIYPFTKRYTNMPQMFLGTVWSWSIPMAYAAQTGTVPVEAWWLFAANWCWTVAY 180

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA 247
           DT+YA  D+ DD  +G+ STA LF    +  + +     + CF++A
Sbjct: 181 DTMYAMVDRDDDLKVGIKSTAILFGRYDRQIIGLFQLAALSCFIIA 226


>gi|67920928|ref|ZP_00514447.1| 4-hydroxybenzoate polyprenyl transferase, proteobacterial
           [Crocosphaera watsonii WH 8501]
 gi|67857045|gb|EAM52285.1| 4-hydroxybenzoate polyprenyl transferase, proteobacterial
           [Crocosphaera watsonii WH 8501]
          Length = 294

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 100/204 (49%), Gaps = 9/204 (4%)

Query: 23  VYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAAC 82
           + L RW    G  + ++P LW+  LAA  L    ++G         + I+G + T  A C
Sbjct: 17  IRLLRWDKPAGRLILMIPALWAIFLAARGLPPLPLIG---------VIILGTLATSAAGC 67

Query: 83  TWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFA 142
             NDL D DID QV RT+ RPL     +    ++ A +    + VL    N    C+  A
Sbjct: 68  VINDLWDRDIDPQVERTKKRPLAERSLSIKVGIIIAFISLCCAAVLAFYLNTLSFCLCVA 127

Query: 143 LLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFD 202
            +   + YP +KR    PQ+VL + +   V + W A+        + L   T+FW + FD
Sbjct: 128 AVPFIVCYPLAKRVFPVPQLVLSLAWGFAVLISWTAVTGKLENYTWVLWGITVFWTLGFD 187

Query: 203 TVYAHQDKKDDELIGVNSTARLFS 226
           TVYA  D++DD+ IGVNS+A  F 
Sbjct: 188 TVYAMADREDDQKIGVNSSALFFG 211


>gi|121706448|ref|XP_001271486.1| para-hydroxybenzoate-polyprenyltransferase Coq2, putative
           [Aspergillus clavatus NRRL 1]
 gi|119399634|gb|EAW10060.1| para-hydroxybenzoate-polyprenyltransferase Coq2, putative
           [Aspergillus clavatus NRRL 1]
          Length = 422

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 103/216 (47%), Gaps = 9/216 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R    +G +    PCL+ST+LAA     A  L    +     ++ VGA + RGA
Sbjct: 117 PYAELVRLDKPSGTYYLFFPCLFSTLLAAPMASCATPL---HVLSTAGLFFVGAFIMRGA 173

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C  NDL D ++D  V RT+ RP+  G  +  +ALVF   Q L    +LLQF    +  G
Sbjct: 174 GCAINDLWDRNLDPNVQRTKFRPIARGALSPQKALVFTGSQLLAGLGVLLQFPSQCLWYG 233

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHAS-FSWPAFFLCIGTIF--- 196
              L +   YP +KR    PQ VLG+ F+ G  +G+ AL     S P        ++   
Sbjct: 234 IPSLVLVTAYPLAKRVTYYPQAVLGLTFSWGAIMGFPALGVDLLSDPTALGAAAALYSSC 293

Query: 197 --WVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTK 230
             W V +D +YAH D KDD   G+ S A      TK
Sbjct: 294 VAWTVLYDMIYAHMDIKDDVAAGIKSIALRHEKNTK 329


>gi|113968818|ref|YP_732611.1| 4-hydroxybenzoate octaprenyltransferase [Shewanella sp. MR-4]
 gi|114049044|ref|YP_739594.1| 4-hydroxybenzoate octaprenyltransferase [Shewanella sp. MR-7]
 gi|118574225|sp|Q0HN13|UBIA_SHESM RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|118574226|sp|Q0HQR8|UBIA_SHESR RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|113883502|gb|ABI37554.1| 4-hydroxybenzoate octaprenyltransferase [Shewanella sp. MR-4]
 gi|113890486|gb|ABI44537.1| 4-hydroxybenzoate octaprenyltransferase [Shewanella sp. MR-7]
          Length = 286

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 76/226 (33%), Positives = 118/226 (52%), Gaps = 9/226 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + PCL + VLAA  +    VL          I+I+G ++ R   
Sbjct: 10  YSRLTRLDRPIGTLLLLWPCLMALVLAAGGMPDIKVL---------IIFIIGVVIMRACG 60

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D D+DS V RTRSRPL SG+ +  +AL+  V+  L +F L+L  N  V+ +  
Sbjct: 61  CIINDYADRDLDSHVERTRSRPLASGEISTKEALLLFVILGLAAFGLVLLLNGLVVKLSV 120

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             + ++++YPF+KR    PQ+ LG+ ++  + + + A        A++L     FW V +
Sbjct: 121 VGIILTIIYPFTKRVTNMPQMFLGVVWSWSIPMAYAAQTGEVPIEAWWLFAANWFWTVAY 180

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVA 247
           DT+YA  D+ DD  +G+ STA LF    +  + +     +LCF+ A
Sbjct: 181 DTMYAMVDRDDDLKVGIKSTAILFGQYDRQIIGLFQFAALLCFIAA 226


>gi|254253190|ref|ZP_04946508.1| 4-hydroxybenzoate polyprenyltransferase [Burkholderia dolosa
           AUO158]
 gi|124895799|gb|EAY69679.1| 4-hydroxybenzoate polyprenyltransferase [Burkholderia dolosa
           AUO158]
          Length = 297

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 60/163 (36%), Positives = 89/163 (54%), Gaps = 1/163 (0%)

Query: 65  WYLF-IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
           W LF I+++G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  A +   
Sbjct: 51  WPLFVIFVLGTLLMRSAGCAMNDYADRDFDRHVKRTADRPLTSGKIRAWEAVAIAAVLSF 110

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASF 183
           I+F+L+L  N     +    LF++  YPF KRF   PQ  LGI F  G+ + + A+  + 
Sbjct: 111 IAFLLILPLNTLTKELSVVALFVAGSYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTV 170

Query: 184 SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFS 226
              A+ + I  +FW V +DT YA  D+ DD  IG+ ++A  F 
Sbjct: 171 PPLAWVMLIANVFWSVAYDTEYAMVDRDDDIKIGIRTSALTFG 213


>gi|15603616|ref|NP_246690.1| 4-hydroxybenzoate octaprenyltransferase [Pasteurella multocida
           subsp. multocida str. Pm70]
 gi|13431965|sp|P57970|UBIA_PASMU RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|12722167|gb|AAK03835.1| UbiA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 290

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 120/245 (48%), Gaps = 4/245 (1%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L I+++G I  R A C  ND  D  ID  V RT  RPL +G  T  +A    VL    SF
Sbjct: 47  LSIFVLGVIFMRAAGCVINDYADRHIDGAVKRTSKRPLATGAATPEEAKWLFVLLVFCSF 106

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+L  N + I + F  +F++ +YPF KR+   PQ+ LG+ F   + + +GA   +    
Sbjct: 107 ILVLFLNTYAIVLSFIAVFLAFIYPFMKRYTHLPQLFLGMAFGWSIPMAYGASIEALPLE 166

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFS-YQTK-LWLFILYGIFVLCF 244
            + L    + W V +DT YA  D+ DD  IGV STA LF+ Y  K + L  +  +F L  
Sbjct: 167 CWLLFFANLAWTVAYDTQYAMVDRDDDLRIGVKSTAILFAQYDNKIISLLQIVTLFFLGL 226

Query: 245 MVAFCLLTVNFFAWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIIS 304
           +     L  ++F  + L +A  L + +   +     + C   F +    G ++ +  +  
Sbjct: 227 IGYLSQLHTSYF--VVLFLATLLFVYQCKLIKDRERESCFKAFLNNNYFGAMVFVAFLFG 284

Query: 305 LFLDQ 309
           +F D+
Sbjct: 285 IFFDK 289


>gi|145301044|ref|YP_001143885.1| 4-hydroxybenzoate octaprenyltransferase [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142853816|gb|ABO92137.1| 4-hydroxybenzoate octaprenyltransferase [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 295

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 81/247 (32%), Positives = 129/247 (52%), Gaps = 6/247 (2%)

Query: 64  FWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQAL-VFAVLQF 122
            W L +++VG  + R A C  ND  D + D  V RT  RPLP G+    + L +FAVL  
Sbjct: 51  LWTLLVFVVGVFLMRSAGCVINDYADRNFDGHVKRTAGRPLPMGKVKPREVLALFAVLA- 109

Query: 123 LISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHAS 182
           LISF L+L  N   I + FA L +++ YPF KR+I  PQ+VLG+ F+  + + + A   +
Sbjct: 110 LISFALVLTMNSLTIALSFAALLLAVCYPFMKRYIPIPQLVLGMAFSWSIPMAYAAQANA 169

Query: 183 FSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVL 242
               A+ + +  + W + +DT YA  D+ DD  +G+ S+A LF    K  + +L    +L
Sbjct: 170 LPLVAWLVFLANLLWTIAYDTQYAMVDRDDDLKLGLKSSAILFGRHDKRIIGVLQLATLL 229

Query: 243 CFMVAFCLLTVNFFAWIGLL--IALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILIC 300
             +    L+ +  + + GLL   ALF+  +R+I       + C   F +    G L+ I 
Sbjct: 230 ILLAVGQLMGLGAWYYWGLLGAAALFVYQQRLI--RERQREACFQAFLNNNYAGALVFIG 287

Query: 301 LIISLFL 307
           L+++  L
Sbjct: 288 LVLNYLL 294


>gi|254246275|ref|ZP_04939596.1| 4-hydroxybenzoate polyprenyl transferase, proteobacterial
           [Burkholderia cenocepacia PC184]
 gi|124871051|gb|EAY62767.1| 4-hydroxybenzoate polyprenyl transferase, proteobacterial
           [Burkholderia cenocepacia PC184]
          Length = 297

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 102/202 (50%), Gaps = 12/202 (5%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L I+ +G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV    I+F
Sbjct: 54  LVIFTLGTLLMRSAGCAMNDYADRDFDRHVKRTADRPLTSGKICAWEAVAIAVGLSFIAF 113

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+L  N     +    LF++  YPF KRF   PQ  LGI F  G+ + + A+  +    
Sbjct: 114 LLILPLNTLTKELSVVALFVAGSYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPVL 173

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV 246
           A+ + +  IFW V +DT YA  D+ DD  IG+ ++A            + +G F +  ++
Sbjct: 174 AWVMLVANIFWSVAYDTEYAMVDRDDDIKIGIRTSA------------LTFGRFDVAAVM 221

Query: 247 AFCLLTVNFFAWIGLLIALFLT 268
           A    T+  + WIG+ +   L 
Sbjct: 222 ACYAATLGIYVWIGVTLGFGLA 243


>gi|329910473|ref|ZP_08275314.1| 4-hydroxybenzoate polyprenyltransferase [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327546170|gb|EGF31218.1| 4-hydroxybenzoate polyprenyltransferase [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 293

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 110/211 (52%), Gaps = 5/211 (2%)

Query: 36  LAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQ 95
           + +L  LW T LAA  L   GV  W+     L I+ +G ++ R A C  ND  D DID  
Sbjct: 26  IGILLLLWPT-LAALWLASGGVPDWT----LLCIFTLGTVLMRSAGCAINDYADRDIDRH 80

Query: 96  VLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKR 155
           V RT  RPL +G    ++AL+ A++  L+SF L+L  N     +  A + I+  YP+ KR
Sbjct: 81  VKRTAQRPLTTGLIRSWEALLVALVLALVSFALILPLNALTKQLSIAAVLIAGSYPYFKR 140

Query: 156 FILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDEL 215
           F   PQ  LGI F  G+ + + A+  +    A+ L IG +FW V +DT YA  D+ DD  
Sbjct: 141 FFAIPQAYLGIAFGFGIPMAYAAVLGTVPPEAWVLLIGNVFWAVAYDTEYAMVDRDDDLK 200

Query: 216 IGVNSTARLFSYQTKLWLFILYGIFVLCFMV 246
           IG+ ++A  F       +   Y + +L F+ 
Sbjct: 201 IGIRTSAITFGRYDVAAVMFCYAVSLLLFLA 231


>gi|227329582|ref|ZP_03833606.1| 4-hydroxybenzoate octaprenyltransferase [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 271

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 126/267 (47%), Gaps = 11/267 (4%)

Query: 40  PCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRT 99
           P LW+  LA          G +   W L +++ G  + R A C  ND  D   D  V RT
Sbjct: 15  PTLWALWLAG---------GGAPALWTLLVFVAGVFLMRAAGCVINDYADRHFDGHVKRT 65

Query: 100 RSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILC 159
            SRPLPSG+ +   A V  V+  L++F L+L  N   I +  A L ++ +YPF KR    
Sbjct: 66  ASRPLPSGEVSERAAKVLFVVLVLLAFGLVLTLNKMTIWLSVAGLVLAWVYPFMKRVSHL 125

Query: 160 PQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVN 219
           PQ VLG  F   + + + A+  S     + + +  I W V +DT YA  D+ DD  IGV 
Sbjct: 126 PQFVLGAAFGWSIPMAYAAVSESLPASCWMMFLAYICWTVAYDTQYAMVDRDDDLKIGVK 185

Query: 220 STARLFSYQTKLWLFILYGIFVLCFMVAFCLLT-VNFFAWIGLLIALFLTIKRIIALDIS 278
           STA LF     + + +L    +L  ++A  + T +    +I LL+A  + + + I     
Sbjct: 186 STAILFGRFDNIIIGLLQ-FSMLALLLALGITTGLGTPYYISLLVAAGMFVYQQILTAGR 244

Query: 279 CSKQCCSFFHSAGVVGILILICLIISL 305
               C   FH+    G+ I I ++  L
Sbjct: 245 ERDACFKAFHNNKYAGMAIFIGVLFGL 271


>gi|319410104|emb|CBY90440.1| 4-hydroxybenzoate octaprenyltransferase [Neisseria meningitidis WUE
           2594]
          Length = 341

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 76/273 (27%), Positives = 126/273 (46%), Gaps = 9/273 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L R     G  L + P  W+  LA+  +    VL           + +G  + R A 
Sbjct: 63  YIRLMRADKPIGTLLLLWPTYWALWLASDGIPDLAVLA---------AFTIGTFLMRSAG 113

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D D D  V RT++RP   G+  + +AL+      L++ + L+  N     +  
Sbjct: 114 CVINDFADRDFDGAVERTKNRPFAQGRVKKKEALLLTAFLCLLAALCLIPLNHLTWLMSL 173

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             LF++L YPF+KRF   PQ+ LG+ F+ G+ + + A+  S    A+ L    + W + +
Sbjct: 174 PALFLALTYPFTKRFFPIPQLYLGLAFSFGIPMAFAAVGNSVPVEAWILFTANVLWTLAY 233

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DTVYA  DK+DD  IG+ ++A  F       + + +G F L   V   ++   +  W  +
Sbjct: 234 DTVYAMADKEDDLKIGIKTSAVTFGRYDIAAVMLCHGGFTLLMAVLGAVIGAAWAYWTAI 293

Query: 262 LIALFLTIKRIIALDISCSKQCCSFFHSAGVVG 294
            I L L  ++  A+     + C   F +   +G
Sbjct: 294 PIVLLLQYRQYAAIKSRVRQICFETFLANNRIG 326


>gi|242240804|ref|YP_002988985.1| 4-hydroxybenzoate octaprenyltransferase [Dickeya dadantii Ech703]
 gi|242132861|gb|ACS87163.1| 4-hydroxybenzoate polyprenyl transferase [Dickeya dadantii Ech703]
          Length = 287

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 90/287 (31%), Positives = 131/287 (45%), Gaps = 15/287 (5%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y  L R     G  L + P LW+  LA            +   W L++++ G  + R A 
Sbjct: 13  YCRLMRIDKPIGSMLLLWPTLWALWLAGRG---------TPTLWTLWVFVAGVFLMRAAG 63

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D   D  V RT SRPLPSG  +   A V  V+  L++F L+L  NP  I +  
Sbjct: 64  CVINDYADRHFDGHVKRTASRPLPSGAVSEQSAKVLFVVLVLLAFGLVLTLNPMTIWLSV 123

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             L ++ +YPF KR    PQ+VLG  F   + + + A+  S     + +    I W V +
Sbjct: 124 IGLALAWVYPFMKRVSHLPQLVLGAAFGWSIPMAYAAVSESLPVTCWLMFFAYICWTVAY 183

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTV--NFFAWI 259
           DT YA  D+ DD  IGV STA LF     L + +L  +  L  M+A   +      F W 
Sbjct: 184 DTEYAMVDRDDDLKIGVKSTAILFGSHDTLIIGVLQ-LMTLAAMLALGRMMALSQIFYWS 242

Query: 260 GLLIA-LFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISL 305
            L+ A LF   +++IA        C   F +   VG+++   ++  L
Sbjct: 243 VLIAAGLFAYQQKMIA--GRERDNCFRAFRNNNYVGMVLFFGILFGL 287


>gi|172059706|ref|YP_001807358.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia ambifaria
           MC40-6]
 gi|254790295|sp|B1YTH7|UBIA_BURA4 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|171992223|gb|ACB63142.1| 4-hydroxybenzoate polyprenyl transferase [Burkholderia ambifaria
           MC40-6]
          Length = 290

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 86/160 (53%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L I+ +G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV+   ISF
Sbjct: 44  LAIFALGTLLMRSAGCAMNDYADRDFDRHVKRTADRPLTSGKIRAWEAVAIAVVLAFISF 103

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+   N     +    LF++  YPF KRF   PQ  LGI F  G+ + + A+  +    
Sbjct: 104 LLIQPLNTLTKELSVVALFVAGSYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPML 163

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFS 226
           A+ + I  IFW V +DT YA  D+ DD  IG+ ++A  F 
Sbjct: 164 AWVMLIANIFWSVAYDTEYAMVDRDDDIKIGIRTSALTFG 203


>gi|126276352|ref|XP_001387233.1| Para-hydroxybenzoate--polyprenyltransferase, mitochondrial
           precursor (PHB:polyprenyltransferase) [Scheffersomyces
           stipitis CBS 6054]
 gi|126213102|gb|EAZ63210.1| Para-hydroxybenzoate--polyprenyltransferase, mitochondrial
           precursor (PHB:polyprenyltransferase) [Pichia stipitis
           CBS 6054]
          Length = 285

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 137/282 (48%), Gaps = 5/282 (1%)

Query: 27  RWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAACTWND 86
           R     G  L ++P  W   +A+Y +  A  L  +T  + + ++ +GA++ RGA CT ND
Sbjct: 2   RLEKPVGTLLLLIPSFWGITMASYSI--AAPL--TTSLYAIALFSIGAVIMRGAGCTIND 57

Query: 87  LVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGFALLFI 146
           + D D+D+QV RT  RP+ SG+ T  QA+ +  +Q      +LL        +G   L  
Sbjct: 58  IWDRDLDNQVARTMERPITSGRVTVPQAVAWMGVQCFAGLAVLLSLPFECFYLGALSLPF 117

Query: 147 SLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSW-PAFFLCIGTIFWVVYFDTVY 205
              YP  KRF   PQ +L I F+ G  +G+ A+ A+ +W  A  L I    W + +DT+Y
Sbjct: 118 VAAYPLFKRFTYYPQAMLSICFSWGCLLGFPAVGAAVNWYVAGPLFIANWIWCLTYDTIY 177

Query: 206 AHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGLLIAL 265
           AHQDK+ D   G+ STA  +  +TK  L  L       +  A  L ++    +I  + A 
Sbjct: 178 AHQDKQFDIKAGIKSTALAWGDKTKPILKGLTYTQAAFYTAAGVLNSMGPGFYITGVWAF 237

Query: 266 FLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFL 307
                +I  +++   K C S F S    G +  + +++   L
Sbjct: 238 TRLYNQIRKVNLDDQKSCWSAFTSNIKTGFIFWLGMVVDYLL 279


>gi|73542488|ref|YP_297008.1| 4-hydroxybenzoate octaprenyltransferase [Ralstonia eutropha JMP134]
 gi|118574219|sp|Q46XG9|UBIA_RALEJ RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|72119901|gb|AAZ62164.1| 4-hydroxybenzoate octaprenyltransferase [Ralstonia eutropha JMP134]
          Length = 285

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 100/196 (51%)

Query: 69  IYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVL 128
           I+  G  + R A C  ND  D D D  V RT+ RPL +G+   ++A++ A +  LI+F L
Sbjct: 46  IFFAGTFLMRSAGCAINDYADRDFDKHVKRTKERPLTAGKIAAWEAVLIAAVLALIAFAL 105

Query: 129 LLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAF 188
           +L  N     +      ++  YPF KRF   PQ  LGI F  G+ + + A+       A+
Sbjct: 106 ILPLNSLTKWLAVVAAVVAGTYPFFKRFFAIPQAYLGIAFGFGIPMAFAAVQDQVPLVAW 165

Query: 189 FLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAF 248
            + +  +FW V +DT YA  D+ DD LIG+ ++A  F       + + Y  F++    A 
Sbjct: 166 VMLLANVFWAVAYDTAYAMVDRDDDLLIGIKTSAITFGRFDVAAIMLCYAAFLVLMGWAG 225

Query: 249 CLLTVNFFAWIGLLIA 264
            +L++ +  W+GL  A
Sbjct: 226 VMLSLGWPYWVGLAAA 241


>gi|121634532|ref|YP_974777.1| 4-hydroxybenzoate octaprenyltransferase [Neisseria meningitidis
           FAM18]
 gi|161869677|ref|YP_001598844.1| 4-hydroxybenzoate octaprenyltransferase [Neisseria meningitidis
           053442]
 gi|167011552|sp|A1KSZ7|UBIA_NEIMF RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|189036995|sp|A9M390|UBIA_NEIM0 RecName: Full=4-hydroxybenzoate octaprenyltransferase; AltName:
           Full=4-HB polyprenyltransferase
 gi|120866238|emb|CAM09979.1| putative 4-hydroxybenzoate octaprenyltransferase [Neisseria
           meningitidis FAM18]
 gi|161595230|gb|ABX72890.1| 4-hydroxybenzoate octaprenyltransferase [Neisseria meningitidis
           053442]
 gi|325127840|gb|EGC50747.1| 4-hydroxybenzoate polyprenyl transferase [Neisseria meningitidis
           N1568]
 gi|325131810|gb|EGC54510.1| 4-hydroxybenzoate polyprenyl transferase [Neisseria meningitidis
           M6190]
 gi|325137860|gb|EGC60435.1| 4-hydroxybenzoate polyprenyl transferase [Neisseria meningitidis
           ES14902]
          Length = 296

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 76/273 (27%), Positives = 126/273 (46%), Gaps = 9/273 (3%)

Query: 22  YVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGAA 81
           Y+ L R     G  L + P  W+  LA+  +    VL           + +G  + R A 
Sbjct: 18  YLRLMRADKPIGTLLLLWPTYWALWLASDGIPDLAVLA---------AFTIGTFLMRSAG 68

Query: 82  CTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVGF 141
           C  ND  D D D  V RT++RP   G+  + +AL+      L++ + L+  N     +  
Sbjct: 69  CVINDFADRDFDGAVERTKNRPFAQGRVKKKEALLLTAFLCLLAALCLIPLNHLTWLMSL 128

Query: 142 ALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVYF 201
             LF++L YPF+KRF   PQ+ LG+ F+ G+ + + A+  S    A+ L    + W + +
Sbjct: 129 PALFLALTYPFTKRFFPIPQLYLGLAFSFGIPMAFAAVGNSVPVEAWILFTANVLWTLAY 188

Query: 202 DTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIGL 261
           DTVYA  DK+DD  IG+ ++A  F       + + +G F L   V   ++   +  W  +
Sbjct: 189 DTVYAMADKEDDLKIGIKTSAVTFGRYDIAAVMLCHGGFTLLMAVLGAVIGAAWAYWTAI 248

Query: 262 LIALFLTIKRIIALDISCSKQCCSFFHSAGVVG 294
            I L L  ++  A+     + C   F +   +G
Sbjct: 249 PIVLLLQYRQYAAIKSRVRQICFETFLANNRIG 281


>gi|167586209|ref|ZP_02378597.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia ubonensis Bu]
          Length = 287

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 100/195 (51%), Gaps = 12/195 (6%)

Query: 67  LFIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISF 126
           L I+ +G ++ R A C  ND  D D D  V RT  RPL SG+   ++A+  AV   L++F
Sbjct: 44  LVIFALGTLLMRSAGCAINDYADRDFDRHVKRTADRPLTSGKIRAWEAIAIAVGLALVAF 103

Query: 127 VLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWP 186
           +L+L  N     +    + ++  YPF KRF   PQ  LGI F  G+ + + A+  +    
Sbjct: 104 LLILPLNTLTKELSVVAVIVAGTYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTVPML 163

Query: 187 AFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMV 246
           A+ + I  +FW V +DT YA  D+ DD  IG+ ++A            + +G F +  ++
Sbjct: 164 AWVMLIANVFWSVAYDTEYAMVDRDDDIKIGIRTSA------------LTFGRFDVAAVM 211

Query: 247 AFCLLTVNFFAWIGL 261
           A    T+  + W+GL
Sbjct: 212 ACYAATLGIYVWVGL 226


>gi|53720469|ref|YP_109455.1| 4-hydroxybenzoate octaprenyltran