RPSBLAST alignment for GI: 254780205 and conserved domain: PRK12848

>gnl|CDD|183790 PRK12848, ubiA, 4-hydroxybenzoate octaprenyltransferase; Reviewed. Length = 282
 Score =  170 bits (433), Expect = 4e-43
 Identities = 87/249 (34%), Positives = 126/249 (50%), Gaps = 9/249 (3%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
            Y  L R     G  L + P LW+  LAA      G+       W L ++++G  + R A
Sbjct: 7   AYARLMRLDKPIGTLLLLWPTLWALWLAA-----DGIPDL----WVLVVFVLGVFLMRAA 57

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            C  ND  D D D  V RT++RPL SG  +  +AL   V+  L++F+L+L  N   I + 
Sbjct: 58  GCVINDYADRDFDGHVKRTKNRPLASGAVSEKEALALFVVLVLVAFLLVLTLNTLTIWLS 117

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPAFFLCIGTIFWVVY 200
            A L ++ +YPF KR+   PQVVLG  F  G+ + + A+  S    A+ L +  I W V 
Sbjct: 118 VAALALAWIYPFMKRYTHLPQVVLGAAFGWGIPMAFAAVQGSVPLEAWLLFLANILWTVA 177

Query: 201 FDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLFILYGIFVLCFMVAFCLLTVNFFAWIG 260
           +DT YA  D+ DD  IG+ STA LF    KL + +L    +     A  LL + +  + G
Sbjct: 178 YDTQYAMVDRDDDLKIGIKSTAILFGRYDKLIIGLLQLATLALLAWAGWLLGLGWAYYWG 237

Query: 261 LLIALFLTI 269
           LL+A  L +
Sbjct: 238 LLVAAALFV 246