RPSBLAST alignment for GI: 254780205 and conserved domain: PRK12882

>gnl|CDD|183811 PRK12882, ubiA, prenyltransferase; Reviewed. Length = 276
 Score = 39.2 bits (92), Expect = 0.001
 Identities = 25/89 (28%), Positives = 38/89 (42%), Gaps = 5/89 (5%)

Query: 68  FIYIVGAIVTRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFV 127
             +    + T GA    ND  D +ID   +    RP+PSG  +   AL F++L F     
Sbjct: 42  LAFAAVFLAT-GAGNAINDYFDREIDR--INRPDRPIPSGAVSPRGALAFSILLFAAGVA 98

Query: 128 LLLQFNPFVICVGFALLFISLLYPFSKRF 156
           L     P  +C+  AL    LL  +++  
Sbjct: 99  LAFLLPP--LCLAIALFNSLLLVLYAETL 125