RPSBLAST alignment for GI: 254780205 and conserved domain: PRK13106

>gnl|CDD|183862 PRK13106, ubiA, prenyltransferase; Reviewed. Length = 300
 Score = 62.4 bits (152), Expect = 2e-10
 Identities = 49/211 (23%), Positives = 79/211 (37%), Gaps = 23/211 (10%)

Query: 65  WYLFIYIVGAIV-TRGAACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123
               I I  A+   R A  T ++L D +ID++  RT++RPL +G     +A        +
Sbjct: 48  ISTLILIFLALFFLRTAGMTNDNLADLEIDAKNPRTKNRPLVTGAIKISEAKALITAGLI 107

Query: 124 ISFVLLLQFNPFVICVGFALLFISLLYPFSKRFILCPQ----VVLGIGFAGGVFVGWGAL 179
           + F      N + + +   +  I++ YP+ KR+          + G+    G     G  
Sbjct: 108 LFFASAYLVNRWALLLSPIVALIAMSYPYMKRYTAFANYHLASIQGLAVFSGAVAVLGLY 167

Query: 180 HASF-----SWPAFFLCIGTIFWVVYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWLF 234
             S        P  F+ IGTI W   FD      D + D  +G++S A +          
Sbjct: 168 ANSLIQVLLRVPWLFV-IGTILWAAGFDLYNHIPDAEFDREMGLHSFAVVL--------- 217

Query: 235 ILYGIFVLCFMVAFCLLTVNFFAWIGLLIAL 265
              G + L F     L +V       L   L
Sbjct: 218 ---GKWALTFAGLNQLFSVVLDLLGDLYYGL 245