RPSBLAST alignment for GI: 254780205 and conserved domain: KOG1381

>gnl|CDD|36595 KOG1381, KOG1381, KOG1381, Para-hydroxybenzoate-polyprenyl transferase [Coenzyme transport and metabolism]. Length = 353
 Score =  174 bits (442), Expect = 3e-44
 Identities = 104/294 (35%), Positives = 144/294 (48%), Gaps = 14/294 (4%)

Query: 21  PYVYLARWHSSTGWHLAVLPCLWSTVLAAYPLRRAGVLGWSTIFWYLFIYIVGAIVTRGA 80
           PY  L R     G  L   PC WS  +AA         G       L ++ VGA++ RGA
Sbjct: 66  PYAQLMRLDKPIGTWLLYWPCTWSIAMAADA-------GLLPSIKMLALFGVGALLMRGA 118

Query: 81  ACTWNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFLISFVLLLQFNPFVICVG 140
            CT NDL D D+D++V RT+ RPL SG  +  QA+ F   Q  +   +LLQ N + I +G
Sbjct: 119 GCTINDLWDKDLDAKVERTKLRPLASGSLSPRQAIGFLGAQLSLGLGILLQLNWYSIALG 178

Query: 141 FALLFISLLYPFSKRFILCPQVVLGIGFAGGVFVGWGALHASFSWPA--FFLCIGTIFWV 198
            + L + + YP  KRF   PQ+VLG+ F  G  +GW AL  S   P+    L +  + W 
Sbjct: 179 ASSLALVITYPLMKRFTYWPQLVLGLTFNWGALLGWCALKGS-LSPSAVLPLYLSGVCWT 237

Query: 199 VYFDTVYAHQDKKDDELIGVNSTARLFSYQTKLWL--FILYGIFVLCFMVAFCLLTVNFF 256
           + +DT+YAHQDK+DD  IGV STA  F   TK WL  F    I  L         T  ++
Sbjct: 238 LIYDTIYAHQDKRDDVKIGVKSTALRFGDNTKPWLSGFGAAQIASLAAAGIASDQTWPYY 297

Query: 257 AWIGLLIALFLTIKRIIALDISCSKQCCSFFHSAGVVGILILICLIISLFLDQF 310
           A +G + A      +I  +DI     C   F S    G+++   +++   L  F
Sbjct: 298 AALGAVAARL--GSQIYKVDIDNPSDCWKKFKSNSNTGLILFSGIVLDTLLKSF 349