RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780205|ref|YP_003064618.1| prenyltransferase [Candidatus Liberibacter asiaticus str. psy62] (310 letters) >d1vjja4 d.3.1.4 (A:141-461) Transglutaminase catalytic domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]} Length = 321 Score = 27.1 bits (60), Expect = 1.9 Identities = 11/40 (27%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Query: 84 WNDLVDHDIDSQVLRTRSRPLPSGQCTRFQALVFAVLQFL 123 WN V+ I ++ P+ GQC F + L+ L Sbjct: 109 WNGSVE--ILKNWKKSGLSPVRYGQCWVFAGTLNTALRSL 146 >d2z0da1 d.3.1.22 (A:5-354) Cysteine protease ATG4B {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Score = 24.6 bits (53), Expect = 10.0 Identities = 12/34 (35%), Positives = 15/34 (44%) Query: 261 LLIALFLTIKRIIALDISCSKQCCSFFHSAGVVG 294 LLI L L + I + K C S GV+G Sbjct: 220 LLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIG 253 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.337 0.147 0.510 Gapped Lambda K H 0.267 0.0442 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,227,262 Number of extensions: 55876 Number of successful extensions: 195 Number of sequences better than 10.0: 1 Number of HSP's gapped: 193 Number of HSP's successfully gapped: 28 Length of query: 310 Length of database: 2,407,596 Length adjustment: 85 Effective length of query: 225 Effective length of database: 1,240,546 Effective search space: 279122850 Effective search space used: 279122850 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 53 (24.9 bits)