HHsearch alignment for GI: 254780206 and conserved domain: PRK06019

>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed.
Probab=99.95  E-value=1e-25  Score=205.88  Aligned_cols=359  Identities=19%  Similarity=0.217  Sum_probs=243.2

Q ss_pred             CEEEEECCC--HHHHHHHHHHHHCCCCCEEEEECC-C-HHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHH
Q ss_conf             958998865--889999999985899678999549-8-357511705512878989999999871897999979557874
Q gi|254780206|r    1 MRVLLIGSG--GREHALAWKIAQSPLLSELWSIPG-N-PGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVN   76 (424)
Q Consensus         1 MkILviGsG--grEhAl~~~l~~s~~~~~v~~~pg-N-~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~   76 (424)
T Consensus         8 ~tIGIlGgGQLgrMl--a~aA~~lG~~v~v-ldp~~~~PA~~va~~~~~~~~~D~~al~~fa~~--~DviT~E~EnI-~~   81 (377)
T PRK06019          8 KTIGIIGGGQLGRML--ALAAAPLGYKVIV-LDPDADCPAAQVADRVIVADYDDVAALRELAEQ--CDVITYEFENV-PA   81 (377)
T ss_pred             CEEEEECCCHHHHHH--HHHHHHCCCEEEE-ECCCCCCCHHHHCCEEEECCCCCHHHHHHHHHC--CCEEEECCCCC-CH
T ss_conf             999998786899999--9999978998999-848984984783784898688989999999845--99999781768-99


Q ss_pred             HHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEEC-CCCCCCCCCC
Q ss_conf             899898605880670106665552010235788876531011112234401111121012420256304-6534300023
Q gi|254780206|r   77 GISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKAD-GLCAGKGVVV  155 (424)
Q Consensus        77 gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~-~~agGkGV~i  155 (424)
T Consensus        82 ~~L~~le~~-~~v~-P~~~al~i~QdR~~eK~~l~~lgiptapf~~v~s~~dl~~~~~~lg~P~vlKt~~~GYDGKGq~~  159 (377)
T PRK06019         82 EALDLLAAR-VPVP-PGPDALAIAQDRLTEKQFLDELGIPVAPFALVDSAEDLDAAIADLGLPAVLKTRRGGYDGKGQWV  159 (377)
T ss_pred             HHHHHHHHC-CCCC-CCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCHHHHHHHHHHCCCCEEEECCCCCCCCCCCEE
T ss_conf             999999708-9668-79899998862799999999769998880671899999999997299769951334618870189


Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHC-CCCCEEEECCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCC
Q ss_conf             235677888788751445317778877520-57523442157-7631035200011135665444443443000012344
Q gi|254780206|r  156 AATVDEATSAIDRCFQQINSTVIIEEYLEG-FEVSFFALCDG-KTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS  233 (424)
Q Consensus       156 ~~~~~e~~~~~~~~~~~~~~~VliEefl~G-~E~Sv~~i~dG-~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~~~~  233 (424)
T Consensus       160 i~s~~dl~~a~~~l~---~~~~i~E~~i~f~~ElSvivaR~~~G~~~~yP~~en~h~~--gil------~~s~~Pa~-~~  227 (377)
T PRK06019        160 LRSEADLDAAWAALG---SGPCILEEFVPFEREVSVIVARGRDGEVVFYPLVENVHRN--GIL------RTSIAPAP-IS  227 (377)
T ss_pred             ECCHHHHHHHHHHCC---CCCEEEEEEECCEEEEEEEEEECCCCCEEEECCHHCEEEC--CEE------EEEECCCC-CC
T ss_conf             778889999998656---9988999654351899999998489999994441147777--755------89988999-99


Q ss_pred             CCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHCCCCC
Q ss_conf             32220100000899999862046235664454489855704899988651477510443326544115666542013333
Q gi|254780206|r  234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNLHN  313 (424)
Q Consensus       234 ~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~L~~dl~~il~~~~~g~L~~  313 (424)
T Consensus       228 ~~~~~~a-~~ia~~i~~~-----l~~vGvl~VE~F~~~~~llvNEiAPRpHNSGH~Ti~~~~~SQFe~HlRAi~glpl~~  301 (377)
T PRK06019        228 ADLQAQA-EEIASRIAEE-----LDYVGVLAVEFFVTGDGLLVNEIAPRVHNSGHWTIDACSTSQFEQHLRAIAGLPLGS  301 (377)
T ss_pred             HHHHHHH-HHHHHHHHHH-----CCCCCEEEEEEEEECCCEEEEEECCCCCCCCCEEECCCCCCHHHHHHHHHCCCCCCC
T ss_conf             9999999-9999999997-----487624999999918938999725887687547642341248999999982998888


Q ss_pred             CCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCEEEECCCC-EEEEEEECCCHHHHHHHHH
Q ss_conf             212344442067542254466877579762487666898689983358778879981880-7999996289899999999
Q gi|254780206|r  314 THINWKAEYALTVVVATKGYPEEYPHGTIISKIP