Query gi|254780207|ref|YP_003064620.1| hypothetical protein CLIBASIA_00460 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 98 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 23 13:13:54 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780207.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR01371 met_syn_B12ind 5-met 86.7 0.17 4.3E-06 28.7 -0.0 17 20-36 713-729 (778) 2 PRK05222 5-methyltetrahydropte 65.4 1.5 3.7E-05 23.7 -0.4 18 19-36 687-704 (756) 3 TIGR02826 RNR_activ_nrdG3 anae 61.5 2.9 7.3E-05 22.1 0.5 22 65-86 54-81 (165) 4 KOG2263 consensus 48.1 4.9 0.00012 20.9 -0.1 28 9-36 680-712 (765) 5 pfam04596 Pox_F15 Poxvirus pro 31.0 37 0.00095 16.2 2.2 30 18-47 27-56 (137) 6 TIGR02903 spore_lon_C ATP-depe 19.4 42 0.0011 15.9 0.7 10 87-96 311-320 (616) 7 pfam03402 V1R Vomeronasal orga 14.0 83 0.0021 14.3 1.1 18 19-36 178-195 (265) 8 TIGR01279 DPOR_bchN light-inde 14.0 76 0.0019 14.5 0.9 20 64-83 306-325 (458) 9 TIGR00539 hemN_rel putative ox 13.6 58 0.0015 15.1 0.2 55 39-97 13-83 (371) 10 COG3677 Transposase and inacti 12.9 55 0.0014 15.2 -0.1 60 9-69 12-84 (129) No 1 >TIGR01371 met_syn_B12ind 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase; InterPro: IPR006276 This group represents cobalamin-independent methionine synthase. A family of uncharacterised archaeal proteins having substantial homology to the C-terminal region of this family, are not included in this group, though they are contained in a larger family of vitamin-B12 independent methionine synthase.; GO: 0003871 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity, 0009086 methionine biosynthetic process. Probab=86.72 E-value=0.17 Score=28.71 Aligned_cols=17 Identities=41% Similarity=0.813 Sum_probs=13.5 Q ss_pred EEEEEECCCCCCCCCEE Q ss_conf 15777408740023205 Q gi|254780207|r 20 AQVYHIHSPRIATKSSI 36 (98) Q Consensus 20 aqvyhihspriatkssi 36 (98) --||-||||||-.+..| T Consensus 713 pGVYDIHSPRvPS~eE~ 729 (778) T TIGR01371 713 PGVYDIHSPRVPSVEEM 729 (778) T ss_pred CCEEECCCCCCCHHHHH T ss_conf 72132268886738999 No 2 >PRK05222 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase; Provisional Probab=65.41 E-value=1.5 Score=23.69 Aligned_cols=18 Identities=44% Similarity=0.778 Sum_probs=13.6 Q ss_pred CEEEEEECCCCCCCCCEE Q ss_conf 115777408740023205 Q gi|254780207|r 19 RAQVYHIHSPRIATKSSI 36 (98) Q Consensus 19 raqvyhihspriatkssi 36 (98) -.-||.||||||.+...| T Consensus 687 GpGVYDIHSPrvPsveEi 704 (756) T PRK05222 687 GPGVYDIHSPRVPSVEEI 704 (756) T ss_pred CCCCCCCCCCCCCCHHHH T ss_conf 780012578999998999 No 3 >TIGR02826 RNR_activ_nrdG3 anaerobic ribonucleoside-triphosphate reductase activating protein; InterPro: IPR014191 Members of this entry represent a set of proteins related to, yet architecturally different from, the activating protein for the glycine radical-containing, oxygen-sensitive ribonucleoside-triphosphate reductase (RNR, see IPR012837 from INTERPRO). Members of this entry are found paired with members of a similarly divergent set of anaerobic ribonucleoside-triphosphate reductases. Identification of these proteins as RNR activating proteins is partly from pairing with the candidate RNR and further supported by the finding that upstream of these operons are examples of a conserved regulatory element that is found in nearly all bacteria and that occurs specifically upstream of operons for all three classes of RNR genes .. Probab=61.50 E-value=2.9 Score=22.14 Aligned_cols=22 Identities=41% Similarity=0.813 Sum_probs=19.5 Q ss_pred HHHHCCCEEEEE------ECCCCCCCHH Q ss_conf 643024202462------1233588616 Q gi|254780207|r 65 EELIDGKKAMIT------TDNFMGGEPI 86 (98) Q Consensus 65 eelidgkkamit------tdnfmggepi 86 (98) +++++-+...|| -=-||||||+ T Consensus 54 ~~~l~~y~~~I~RYFPK~Cv~FlGGEPL 81 (165) T TIGR02826 54 AQLLDKYRSLITRYFPKVCVLFLGGEPL 81 (165) T ss_pred HHHHHHHCCCCCHHHHHHEEEECCCCCC T ss_conf 9999874000101210020200478988 No 4 >KOG2263 consensus Probab=48.14 E-value=4.9 Score=20.90 Aligned_cols=28 Identities=43% Similarity=0.648 Sum_probs=18.5 Q ss_pred HHHHHHC-----CCCCEEEEEECCCCCCCCCEE Q ss_conf 9998602-----320115777408740023205 Q gi|254780207|r 9 LLSILTT-----NIARAQVYHIHSPRIATKSSI 36 (98) Q Consensus 9 llsiltt-----niaraqvyhihspriatkssi 36 (98) |||.+.. +--...||.||||||..++.| T Consensus 680 llsvf~~gvkY~~~IGpG~~DIHSPRiPs~dE~ 712 (765) T KOG2263 680 LLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEI 712 (765) T ss_pred HHHHHHCCCCCCCCCCCCEECCCCCCCCCHHHH T ss_conf 999986147656776875000468999987899 No 5 >pfam04596 Pox_F15 Poxvirus protein F15. Probab=30.96 E-value=37 Score=16.16 Aligned_cols=30 Identities=30% Similarity=0.465 Sum_probs=26.4 Q ss_pred CCEEEEEECCCCCCCCCEEEEEEEEEEECH Q ss_conf 011577740874002320588973345134 Q gi|254780207|r 18 ARAQVYHIHSPRIATKSSIHIKCHSCTLNK 47 (98) Q Consensus 18 araqvyhihspriatkssihikchsctlnk 47 (98) --++|+|+-.--+.|..++|++-|+-||.. T Consensus 27 Ki~~V~~~P~n~v~ts~~v~~~g~~FtL~E 56 (137) T pfam04596 27 KIDEVRHMPRNSVNTSESVHIRGHKFTLSE 56 (137) T ss_pred EEEEEEECCCCCCCCCCEEEECCCEEEEHH T ss_conf 830166456551066544899074127088 No 6 >TIGR02903 spore_lon_C ATP-dependent protease, Lon family; InterPro: IPR014252 This entry shows some relation to the widely distributed ATP-dependent protease La, also called Lon or LonA (IPR004815 from INTERPRO), but is more closely related to LonB (IPR014251 from INTERPRO), a LonA paralog found only in endospore-forming bacteria. Proteins in this entry are unassigned peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SJ). They are restricted to a subset of endospore-forming species, and probably participate in the program of endospore formation. We propose the designation LonC.. Probab=19.45 E-value=42 Score=15.87 Aligned_cols=10 Identities=60% Similarity=0.953 Sum_probs=6.9 Q ss_pred HHHHHHHHHC Q ss_conf 8999986530 Q gi|254780207|r 87 TFIKYLFEED 96 (98) Q Consensus 87 tfikylfeed 96 (98) -+||||||+. T Consensus 311 kYIK~lFe~G 320 (616) T TIGR02903 311 KYIKKLFEEG 320 (616) T ss_pred HHHHHHHCCC T ss_conf 5888852268 No 7 >pfam03402 V1R Vomeronasal organ pheromone receptor family, V1R. This family represents one of two known vomeronasal organ receptor families, the V1R family. Probab=14.03 E-value=83 Score=14.29 Aligned_cols=18 Identities=22% Similarity=0.401 Sum_probs=10.6 Q ss_pred CEEEEEECCCCCCCCCEE Q ss_conf 115777408740023205 Q gi|254780207|r 19 RAQVYHIHSPRIATKSSI 36 (98) Q Consensus 19 raqvyhihspriatkssi 36 (98) +-||-|||+++...++|- T Consensus 178 ~qqVqhihs~~~s~r~sP 195 (265) T pfam03402 178 KKQAQHLQGTSLSPKASP 195 (265) T ss_pred CCCEEECCCCCCCCCCCH T ss_conf 651575638899999887 No 8 >TIGR01279 DPOR_bchN light-independent protochlorophyllide reductase, N subunit; InterPro: IPR005970 Synonym: dark protochlorophyllide reductase Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls. The light-independent (dark) form of protochlorophyllide reductase plays a key role in the ability of gymnosperms, algae, and photosynthetic bacteria to form chlorophyll in the dark. Genetic and sequence analyses have indicated that dark protochlorophyllide reductase consists of three protein subunits that exhibit significant sequence similarity to the three subunits of nitrogenase, which catalyzes the reductive formation of ammonia from dinitrogen. Dark protochlorophyllide reductase activity was shown to be dependent on the presence of all three subunits, ATP, and the reductant dithionite. This enzyme describes the N subunit of the dark form protochlorophyllide reductase, a nitrogenase-like enzyme . ; GO: 0016730 oxidoreductase activity acting on iron-sulfur proteins as donors, 0015995 chlorophyll biosynthetic process, 0019685 photosynthesis dark reaction. Probab=13.95 E-value=76 Score=14.49 Aligned_cols=20 Identities=30% Similarity=0.488 Sum_probs=16.4 Q ss_pred HHHHHCCCEEEEEECCCCCC Q ss_conf 46430242024621233588 Q gi|254780207|r 64 KEELIDGKKAMITTDNFMGG 83 (98) Q Consensus 64 keelidgkkamittdnfmgg 83 (98) .-.|+.|||-|...||.|-= T Consensus 306 ~~~lLrGkkifF~~D~llEl 325 (458) T TIGR01279 306 HTQLLRGKKIFFLGDNLLEL 325 (458) T ss_pred HHHHHCCCEEEECCCCHHHH T ss_conf 88877387578547614566 No 9 >TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase; InterPro: IPR004559 Experimentally determined examples of oxygen-independent coproporphyrinogen III oxidase, an enzyme that replaces HemF function under anaerobic conditions, belong to a family of proteins called HemN (IPR004558 from INTERPRO). This family contains a closely related protein, shorter at the amino end and lacking the region containing the motif PYRT[SC]YP found in members of the hemN family. Several species, including Escherichia coli, Helicobacter pylori, Aquifex aeolicus, and Chlamydia trachomatis, have members of both this family and the Escherichia coli hemN family. The member of this family from Bacillus subtilis was shown to complement a hemF/hemN double mutant of Salmonella typhimurium and to prevent accumulation of coproporphyrinogen III under anaerobic conditions, but the exact role of this protein is still uncertain. It is found in a number of species that do not synthesize haem de novo. ; GO: 0004109 coproporphyrinogen oxidase activity, 0006779 porphyrin biosynthetic process, 0005737 cytoplasm. Probab=13.64 E-value=58 Score=15.14 Aligned_cols=55 Identities=33% Similarity=0.528 Sum_probs=30.5 Q ss_pred EEEEEEECHHHCCC-CCCCCCCEEECHHHHHCCCEEEEEEC----------CCC-CCCHHHH----HHHHHHHCC Q ss_conf 97334513444255-87754301111464302420246212----------335-8861689----999865305 Q gi|254780207|r 39 KCHSCTLNKHHINK-TPSSSSAVYTKKEELIDGKKAMITTD----------NFM-GGEPITF----IKYLFEEDK 97 (98) Q Consensus 39 kchsctlnkhhink-tpssssavytkkeelidgkkamittd----------nfm-ggepitf----ikylfeedk 97 (98) |||-|..|+|.+.. .|... -++.-..+|+ .++-.|+ -|. ||.|-+| ++|||++=+ T Consensus 13 kC~YCdFNsy~~ksd~p~~e-Y~~aL~~dl~---~~l~~t~dsiqQ~~l~siFIGGGTP~~lS~e~~~~l~~~I~ 83 (371) T TIGR00539 13 KCGYCDFNSYAQKSDIPKEE-YLQALLQDLK---AALAKTDDSIQQEDLKSIFIGGGTPSLLSAEALKKLLEEIK 83 (371) T ss_pred CCCCCCCCCHHHHCCCCHHH-HHHHHHHHHH---HHHHHCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHH T ss_conf 58886533245542785679-9999999999---99986044323676556885688741468999999999987 No 10 >COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Probab=12.92 E-value=55 Score=15.24 Aligned_cols=60 Identities=25% Similarity=0.251 Sum_probs=33.3 Q ss_pred HHHHHHCCCCCEEEEEECCCCCCCCC-------------EEEEEEEEEEECHHHCCCCCCCCCCEEECHHHHHC Q ss_conf 99986023201157774087400232-------------05889733451344425587754301111464302 Q gi|254780207|r 9 LLSILTTNIARAQVYHIHSPRIATKS-------------SIHIKCHSCTLNKHHINKTPSSSSAVYTKKEELID 69 (98) Q Consensus 9 llsilttniaraqvyhihspriatks-------------sihikchsctlnkhhinktpssssavytkkeelid 69 (98) +-++.-..+++++...+-.+.+.-.. --.-+|++|--+----+.+|-+. +.|-.++..++ T Consensus 12 ~~~~~~~~~~~~~~~~~~~~~cP~C~s~~~~k~g~~~~~~qRyrC~~C~~tf~~~~~~~~~~-~~~~~~~~~~~ 84 (129) T COG3677 12 LKSIALADAAYAIRMQITKVNCPRCKSSNVVKIGGIRRGHQRYKCKSCGSTFTVETGSPLSK-ALYKIKLQAVT 84 (129) T ss_pred HHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCEEEEECCCCCCC-CCHHHHHHHHH T ss_conf 78889999999986541677689888511023777426652535687586001113775312-32779999999 Done!