RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780207|ref|YP_003064620.1| hypothetical protein CLIBASIA_00460 [Candidatus Liberibacter asiaticus str. psy62] (98 letters) >3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} (C:1-129) Length = 129 Score = 26.3 bits (57), Expect = 1.4 Identities = 10/44 (22%), Positives = 17/44 (38%) Query: 1 MRHLILIMLLSILTTNIARAQVYHIHSPRIATKSSIHIKCHSCT 44 M L L++ L +L + + A+ SP + S C Sbjct: 3 MFSLALLLSLLLLCVSDSGAETTVTQSPASLSMSIGEKVTIRCI 46 >2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* (A:100-281) Length = 182 Score = 23.8 bits (50), Expect = 8.2 Identities = 7/51 (13%), Positives = 12/51 (23%) Query: 18 ARAQVYHIHSPRIATKSSIHIKCHSCTLNKHHINKTPSSSSAVYTKKEELI 68 A + S + + H P V + EE + Sbjct: 132 ASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEAL 182 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.321 0.132 0.381 Gapped Lambda K H 0.267 0.0671 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 722,930 Number of extensions: 25685 Number of successful extensions: 46 Number of sequences better than 10.0: 1 Number of HSP's gapped: 46 Number of HSP's successfully gapped: 7 Length of query: 98 Length of database: 4,956,049 Length adjustment: 57 Effective length of query: 41 Effective length of database: 3,029,164 Effective search space: 124195724 Effective search space used: 124195724 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.2 bits)