RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780207|ref|YP_003064620.1| hypothetical protein CLIBASIA_00460 [Candidatus Liberibacter asiaticus str. psy62] (98 letters) >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 25.0 bits (53), Expect = 4.3 Identities = 6/20 (30%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Query: 18 ARAQVYHIHS-PRIATKSSI 36 A ++Y S P +A K+++ Sbjct: 27 ASLKLYADDSAPALAIKATM 46 >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Score = 24.9 bits (54), Expect = 5.0 Identities = 8/40 (20%), Positives = 15/40 (37%), Gaps = 5/40 (12%) Query: 35 SIHIKCHSCTLNKHHINKTPSSSSAVYTK-----KEELID 69 +I + C C + I + S V ++L+D Sbjct: 19 NIVLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVD 58 >1s1i_Y L35, YP55, 60S ribosomal protein L37-A; 80S ribosome, 60S ribosomal subunit, EEF2, tRNA translocation, sordarin, cryo-EM; 11.70A {Saccharomyces cerevisiae} SCOP: i.1.1.1 Length = 87 Score = 23.9 bits (52), Expect = 9.8 Identities = 8/28 (28%), Positives = 10/28 (35%) Query: 37 HIKCHSCTLNKHHINKTPSSSSAVYTKK 64 H C+ C H+ K SS K Sbjct: 15 HTLCNRCGRRSFHVQKKTCSSCGYPAAK 42 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.321 0.132 0.381 Gapped Lambda K H 0.267 0.0593 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 809,803 Number of extensions: 29658 Number of successful extensions: 68 Number of sequences better than 10.0: 1 Number of HSP's gapped: 68 Number of HSP's successfully gapped: 6 Length of query: 98 Length of database: 5,693,230 Length adjustment: 64 Effective length of query: 34 Effective length of database: 4,141,614 Effective search space: 140814876 Effective search space used: 140814876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.3 bits)