RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780208|ref|YP_003064621.1| hypothetical protein CLIBASIA_00465 [Candidatus Liberibacter asiaticus str. psy62] (66 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 27.6 bits (61), Expect = 0.68 Identities = 10/56 (17%), Positives = 19/56 (33%), Gaps = 16/56 (28%) Query: 9 RIMHLFLDQIGNFLMFFPMLRNRHMSIKILKNTLTTAFISSFKSFISRFLHMIANK 64 +++ +F Q GN +F LR+ L T + + + A Sbjct: 155 QLVAIFGGQ-GNTDDYFEELRD-------LYQT--------YHVLVGDLIKFSAET 194 >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Length = 194 Score = 24.3 bits (52), Expect = 7.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Query: 3 IWGMMIRIMHLFLDQ 17 IWGM R++H L+Q Sbjct: 177 IWGMTARVLHDLLEQ 191 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.342 0.145 0.458 Gapped Lambda K H 0.267 0.0513 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 547,891 Number of extensions: 18418 Number of successful extensions: 123 Number of sequences better than 10.0: 1 Number of HSP's gapped: 123 Number of HSP's successfully gapped: 14 Length of query: 66 Length of database: 5,693,230 Length adjustment: 37 Effective length of query: 29 Effective length of database: 4,796,202 Effective search space: 139089858 Effective search space used: 139089858 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (21.5 bits) S2: 50 (23.5 bits)