BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780208|ref|YP_003064621.1| hypothetical protein CLIBASIA_00465 [Candidatus Liberibacter asiaticus str. psy62] (66 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780208|ref|YP_003064621.1| hypothetical protein CLIBASIA_00465 [Candidatus Liberibacter asiaticus str. psy62] Length = 66 Score = 133 bits (334), Expect = 6e-34, Method: Compositional matrix adjust. Identities = 66/66 (100%), Positives = 66/66 (100%) Query: 1 MCIWGMMIRIMHLFLDQIGNFLMFFPMLRNRHMSIKILKNTLTTAFISSFKSFISRFLHM 60 MCIWGMMIRIMHLFLDQIGNFLMFFPMLRNRHMSIKILKNTLTTAFISSFKSFISRFLHM Sbjct: 1 MCIWGMMIRIMHLFLDQIGNFLMFFPMLRNRHMSIKILKNTLTTAFISSFKSFISRFLHM 60 Query: 61 IANKDR 66 IANKDR Sbjct: 61 IANKDR 66 >gi|254780483|ref|YP_003064896.1| putative inner membrane protein translocase component YidC [Candidatus Liberibacter asiaticus str. psy62] Length = 581 Score = 23.9 bits (50), Expect = 0.50, Method: Compositional matrix adjust. Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 12/46 (26%) Query: 7 MIRIMHLFLDQIGNF------------LMFFPMLRNRHMSIKILKN 40 M +M F + +GNF L+FFP+ + +++S +KN Sbjct: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKN 391 >gi|254780395|ref|YP_003064808.1| organic solvent tolerance protein [Candidatus Liberibacter asiaticus str. psy62] Length = 762 Score = 21.6 bits (44), Expect = 2.5, Method: Composition-based stats. Identities = 7/21 (33%), Positives = 14/21 (66%) Query: 8 IRIMHLFLDQIGNFLMFFPML 28 IR+ +L+ GN + +FP++ Sbjct: 194 IRLEKPYLEIFGNSIFYFPLI 214 >gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Score = 21.2 bits (43), Expect = 3.1, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Query: 25 FPMLRNRHMSIKILKNTLTTAFISSFKSFISRFLHM 60 FP+L N H+S LK A +S + S LH+ Sbjct: 23 FPVLENVHLS---LKKGEIVALVSPSGTGKSTILHI 55 >gi|254780268|ref|YP_003064681.1| acetyl-CoA carboxylase biotin carboxylase subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 443 Score = 21.2 bits (43), Expect = 3.1, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 16/37 (43%) Query: 29 RNRHMSIKILKNTLTTAFISSFKSFISRFLHMIANKD 65 +NR + L L I K+ I F +I N+D Sbjct: 390 KNRKECMMRLNRALNEIIIDGIKTTIPLFQKLIKNED 426 >gi|254780129|ref|YP_003064542.1| hypothetical protein CLIBASIA_00040 [Candidatus Liberibacter asiaticus str. psy62] Length = 220 Score = 20.8 bits (42), Expect = 4.1, Method: Composition-based stats. Identities = 7/11 (63%), Positives = 9/11 (81%) Query: 49 SFKSFISRFLH 59 SFKSF+ R+ H Sbjct: 188 SFKSFVERWFH 198 >gi|254780836|ref|YP_003065249.1| putative type I restriction-modification system DNA methylase [Candidatus Liberibacter asiaticus str. psy62] Length = 674 Score = 20.4 bits (41), Expect = 5.9, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 14/29 (48%) Query: 37 ILKNTLTTAFISSFKSFISRFLHMIANKD 65 I N T + + KSFI F++ KD Sbjct: 540 IKSNEAKTLKVKASKSFIVAFINAFGRKD 568 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.342 0.145 0.458 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,378 Number of Sequences: 1233 Number of extensions: 1170 Number of successful extensions: 12 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 9 length of query: 66 length of database: 328,796 effective HSP length: 37 effective length of query: 29 effective length of database: 283,175 effective search space: 8212075 effective search space used: 8212075 T: 11 A: 40 X1: 15 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (21.5 bits) S2: 31 (16.5 bits)