RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780209|ref|YP_003064622.1| hypothetical protein CLIBASIA_00470 [Candidatus Liberibacter asiaticus str. psy62] (51 letters) >gnl|CDD|181351 PRK08284, PRK08284, precorrin 6A synthase; Provisional. Length = 253 Score = 29.0 bits (66), Expect = 0.30 Identities = 10/22 (45%), Positives = 12/22 (54%) Query: 28 KGPSKEEQARIEQIRAEARERR 49 GP E I ++RAEAR R Sbjct: 218 AGPLAEVAEEILRVRAEARARH 239 >gnl|CDD|180800 PRK07030, PRK07030, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional. Length = 466 Score = 27.0 bits (60), Expect = 1.1 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Query: 10 AYLLSSVAISGGLCFNRPKGPSKEEQAR-----IEQIRAE 44 LL ++ + C+ RP+G S EE +R +EQ AE Sbjct: 171 PLLLDTIKVPSPDCYLRPEGMSWEEHSRRMFAHMEQTLAE 210 >gnl|CDD|131487 TIGR02434, CobF, precorrin-6A synthase (deacetylating). This model identifies CobF in High GC gram positive, alphaproteobacteria and pseudomonas-related species. Length = 249 Score = 26.6 bits (59), Expect = 1.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Query: 28 KGPSKEEQARIEQIRAEARER 48 GP E RI ++RA+AR R Sbjct: 217 SGPLAEVGPRIAELRAQARAR 237 >gnl|CDD|152148 pfam11712, Vma12, Endoplasmic reticulum-based factor for assembly of V-ATPase. The yeast vacuolar proton-translocating ATPase (V-ATPase) is the best characterized member of the V-ATPase family. A total of thirteen genes are required for encoding the subunits of the enzyme complex itself and an additional three for providing factors necessary for the assembly of the whole. Vma12 is one of these latter, all three of which are localized to the endoplasmic reticulum. Length = 137 Score = 26.6 bits (59), Expect = 1.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Query: 25 NRPKGPSKEEQARIEQIRAEARERRYQ 51 PS E AR+E++RA ER YQ Sbjct: 15 PPKPEPSPEFLARLERLRAAQEEREYQ 41 >gnl|CDD|185217 PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional. Length = 517 Score = 26.3 bits (59), Expect = 2.0 Identities = 8/14 (57%), Positives = 10/14 (71%) Query: 30 PSKEEQARIEQIRA 43 P K +Q IEQI+A Sbjct: 100 PPKLDQEVIEQIKA 113 >gnl|CDD|178794 PRK00013, groEL, chaperonin GroEL; Reviewed. Length = 542 Score = 24.3 bits (54), Expect = 7.5 Identities = 6/17 (35%), Positives = 11/17 (64%) Query: 28 KGPSKEEQARIEQIRAE 44 G + +AR+ QI+A+ Sbjct: 335 AGDKEAIKARVAQIKAQ 351 >gnl|CDD|162708 TIGR02109, PQQ_syn_pqqE, coenzyme PQQ biosynthesis protein E. This model describes coenzyme PQQ biosynthesis protein E, a gene required for the biosynthesis of pyrrolo-quinoline-quinone (coenzyme PQQ). PQQ is required for some glucose dehydrogenases and alcohol dehydrogenases. Length = 358 Score = 24.3 bits (53), Expect = 7.7 Identities = 7/19 (36%), Positives = 11/19 (57%) Query: 30 PSKEEQARIEQIRAEARER 48 P++ + +I EARER Sbjct: 197 PTRAQLEEATRIVEEARER 215 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.132 0.361 Gapped Lambda K H 0.267 0.0691 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 785,845 Number of extensions: 31598 Number of successful extensions: 186 Number of sequences better than 10.0: 1 Number of HSP's gapped: 186 Number of HSP's successfully gapped: 20 Length of query: 51 Length of database: 5,994,473 Length adjustment: 24 Effective length of query: 27 Effective length of database: 5,475,881 Effective search space: 147848787 Effective search space used: 147848787 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.1 bits)