BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780210|ref|YP_003064623.1| hypothetical protein CLIBASIA_00475 [Candidatus Liberibacter asiaticus str. psy62] (57 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780210|ref|YP_003064623.1| hypothetical protein CLIBASIA_00475 [Candidatus Liberibacter asiaticus str. psy62] Length = 57 Score = 117 bits (292), Expect = 4e-29, Method: Compositional matrix adjust. Identities = 57/57 (100%), Positives = 57/57 (100%) Query: 1 MSLVRYGSLSDHGKVAGEEAPRKKSEQPKREPQPQQENRKFIRRSEISTRTHSLSDH 57 MSLVRYGSLSDHGKVAGEEAPRKKSEQPKREPQPQQENRKFIRRSEISTRTHSLSDH Sbjct: 1 MSLVRYGSLSDHGKVAGEEAPRKKSEQPKREPQPQQENRKFIRRSEISTRTHSLSDH 57 >gi|254780450|ref|YP_003064863.1| two-component sensor histidine kinase/response regulator hybrid protein [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Score = 22.3 bits (46), Expect = 1.4, Method: Compositional matrix adjust. Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Query: 16 AGEEAPRKKSE-QPKREPQPQQENRKF 41 A +A +KS+ P P PQ ENR F Sbjct: 349 ALYDANDQKSDISPIDSPHPQDENRYF 375 >gi|254780289|ref|YP_003064702.1| RNA polymerase sigma factor RpoD [Candidatus Liberibacter asiaticus str. psy62] Length = 682 Score = 20.4 bits (41), Expect = 5.7, Method: Compositional matrix adjust. Identities = 8/21 (38%), Positives = 13/21 (61%) Query: 21 PRKKSEQPKREPQPQQENRKF 41 R+ S + KREP P++ +K Sbjct: 536 ARRMSNKIKREPTPEEIAKKL 556 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.308 0.124 0.342 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,979 Number of Sequences: 1233 Number of extensions: 863 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 57 length of database: 328,796 effective HSP length: 29 effective length of query: 28 effective length of database: 293,039 effective search space: 8205092 effective search space used: 8205092 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (20.8 bits) S2: 31 (16.5 bits)