>cd02958 UAS UAS family; UAS is a domain of unknown function. Most members of this family are uncharacterized proteins with similarity to FAS-associated factor 1 (FAF1) and ETEA because of the presence of a UAS domain N-terminal to a ubiquitin-associated UBX domain. FAF1 is a longer protein, compared to the other members of this family, having additional N-terminal domains, a ubiquitin-associated UBA domain and a nuclear targeting domain. FAF1 is an apoptotic signaling molecule that acts downstream in the Fas signal transduction pathway. It interacts with the cytoplasmic domain of Fas, but not to a Fas mutant that is deficient in signal transduction. ETEA is the protein product of a highly expressed gene in T-cells and eosinophils of atopic dermatitis patients. The presence of the ubiquitin-associated UBX domain in the proteins of this family suggests the possibility of their involvement in ubiquitination. Recently, FAF1 has been shown to interact with valosin-containing protein (VCP),

Probab=96.20 E-value=0.013 Score=37.56 Aligned_cols=93 Identities=17% Similarity=0.246 Sum_probs=56.1 Q ss_pred HHHCCCEEEEEEEECCCCCCCCCCCCC-C-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHC Q ss_conf 986998599996511367663112610-0-00000001233332223444321111222210000000012344589985 Q gi|254780212|r 26 LALGGSKIVLYFYPKDDTSGCTAEAIN-F-SSLKADFDEESTILIGISPDSIASHKKFHQKHNLSITLLADESKEVLKSY 103 (157) Q Consensus 26 ~~l~gk~vvl~f~~~~~tp~C~~e~~~-l-~~~~~~~~~~gv~vv~is~d~~~~~~~~~~~~~~~fpil~D~~~~~~~~~ 103 (157) T Consensus 13 Ak~~~K~llVyl~-~~~~~~~~~~~r~v~~~~~V~~~i~~~fV~w~~d~~~~e-------------------g~~~~~~y 72 (114) T cd02958 13 AKSEKKWLLVYLQ-SEDEFDSQVLNRDLWSNESVKEFIRENFIFWQCDIDSSE-------------------GQRFLQSY 72 (114) T ss_pred HHHHCCEEEEEEE-CCCCCCHHHHHHHHCCCHHHHHHHHHHEEEEEEECCCHH-------------------HHHHHHHC T ss_conf 9971988999984-699743899999845888999999711689863169857-------------------99999866 Q ss_pred CCCCCCCCCCCCCCCCCEEEEEECC-CCEEEEEECCCCCCCCHHHHHHHHH Q ss_conf 9866665576654442107999889-9979999768885789999999999 Q gi|254780212|r 104 DVWKEKSMFGKKYMGVVRTTFLIDE-KGIIAQIWKPVTLKNHAQSVLKMVK 153 (157) Q Consensus 104 gv~~~~~~~~~~~~~~~r~tfiid~-~G~I~~~~~~~~~~~~~~eil~~i~ 153 (157) T Consensus 73 ~~~------------~~P~i~iidp~tge~v~~~~G~~~---p~~~l~~L~ 108 (114) T cd02958 73 KVD------------KYPHIAIIDPRTGEVLKVWSGNIT---PEDLLSQLI 108 (114) T ss_pred CCC------------CCCEEEEEECCCCCEEEEEECCCC---HHHHHHHHH T ss_conf 999------------989799997899959989868999---899999999

HHsearch alignment for GI: 254780212 and conserved domain: cd02958