>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides. The functional unit of typical 2-cys PRX is a homodimer. A unique intermolecular redox-active disulfide center is utilized for its activity. Upon reaction with peroxides, its peroxidatic cysteine is oxidized into a sulfenic acid intermediate which is resolved by bonding with the resolving cysteine from the other subunit of the homodimer. This intermolecular disulfide bond is then reduced by thioredoxin, tryparedoxin or AhpF. Typical 2-cys PRXs, like 1-cys PRXs, form decamers which are stabilized by reduction of the active site cysteine. Typical 2-cys PRX interacts through beta strands at one edge of the monomer (B-type interface) to form the functional homodimer, and uses an A-type interface (similar to the dimeric

Probab=100.00 E-value=7e-40 Score=266.30 Aligned_cols=145 Identities=34% Similarity=0.548 Sum_probs=134.0 Q ss_pred CCCCCCCEEEE----CCCCCEEEHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC Q ss_conf 98653730788----69997882898699859999651136766311261000000000123333222344432111122 Q gi|254780212|r 6 VGDKAPHFVLP----SNDEQEISLLALGGSKIVLYFYPKDDTSGCTAEAINFSSLKADFDEESTILIGISPDSIASHKKF 81 (157) Q Consensus 6 vG~~aP~f~l~----~~~g~~~~l~~l~gk~vvl~f~~~~~tp~C~~e~~~l~~~~~~~~~~gv~vv~is~d~~~~~~~~ 81 (157) T Consensus 1 vGd~aP~F~l~~~~~~~~~~~v~lsd~~Gk~vvL~FyP~dfTp~Ct~E~~~f~~~~~ef~~~g~~vigIS~Ds~~sh~~~ 80 (173) T cd03015 1 VGKKAPDFKATAVVPNGEFKEISLSDYKGKWVVLFFYPLDFTFVCPTEIIAFSDRYEEFKKLNAEVLGVSTDSHFSHLAW 80 (173) T ss_pred CCCCCCCCEEECCCCCCCCCEEEHHHHCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHH T ss_conf 95868987602422898740876899689829999981789952279999999999999846967998607988999999 Q ss_pred CCCC-------CCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEECCCCEEEEEE-CCCCCCCCHHHHHHHHH Q ss_conf 2210-------000000012344589985986666557665444210799988999799997-68885789999999999 Q gi|254780212|r 82 HQKH-------NLSITLLADESKEVLKSYDVWKEKSMFGKKYMGVVRTTFLIDEKGIIAQIW-KPVTLKNHAQSVLKMVK 153 (157) Q Consensus 82 ~~~~-------~~~fpil~D~~~~~~~~~gv~~~~~~~~~~~~~~~r~tfiid~~G~I~~~~-~~~~~~~~~~eil~~i~ 153 (157) T Consensus 81 ~~~~~~~~~~~~l~fplLsD~~~~v~~~yGv~~~~~g------~~~R~tfiID~~g~Ir~~~~~~~~~gr~~~EiLr~l~ 154 (173) T cd03015 81 RNTPRKEGGLGKINFPLLADPKKKISRDYGVLDEEEG------VALRGTFIIDPEGIIRHITVNDLPVGRSVDETLRVLD 154 (173) T ss_pred HHHHHHHCCCCCCCCCEEECCHHHHHHHHCCCCCCCC------CCCEEEEEECCCCEEEEEEECCCCCCCCHHHHHHHHH T ss_conf 8768975687764467677763699998199756568------7751799989998699999738998989999999999 Q ss_pred HHH Q ss_conf 850 Q gi|254780212|r 154 SLK 156 (157) Q Consensus 154 ~L~ 156 (157) T Consensus 155 aLq 157 (173) T cd03015 155 ALQ 157 (173) T ss_pred HHH T ss_conf 862

HHsearch alignment for GI: 254780212 and conserved domain: cd03015