BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780212|ref|YP_003064625.1| bacterioferritin comigratory protein [Candidatus Liberibacter asiaticus str. psy62] (157 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780212|ref|YP_003064625.1| bacterioferritin comigratory protein [Candidatus Liberibacter asiaticus str. psy62] Length = 157 Score = 320 bits (820), Expect = 7e-90, Method: Compositional matrix adjust. Identities = 157/157 (100%), Positives = 157/157 (100%) Query: 1 MTSLSVGDKAPHFVLPSNDEQEISLLALGGSKIVLYFYPKDDTSGCTAEAINFSSLKADF 60 MTSLSVGDKAPHFVLPSNDEQEISLLALGGSKIVLYFYPKDDTSGCTAEAINFSSLKADF Sbjct: 1 MTSLSVGDKAPHFVLPSNDEQEISLLALGGSKIVLYFYPKDDTSGCTAEAINFSSLKADF 60 Query: 61 DEESTILIGISPDSIASHKKFHQKHNLSITLLADESKEVLKSYDVWKEKSMFGKKYMGVV 120 DEESTILIGISPDSIASHKKFHQKHNLSITLLADESKEVLKSYDVWKEKSMFGKKYMGVV Sbjct: 61 DEESTILIGISPDSIASHKKFHQKHNLSITLLADESKEVLKSYDVWKEKSMFGKKYMGVV 120 Query: 121 RTTFLIDEKGIIAQIWKPVTLKNHAQSVLKMVKSLKQ 157 RTTFLIDEKGIIAQIWKPVTLKNHAQSVLKMVKSLKQ Sbjct: 121 RTTFLIDEKGIIAQIWKPVTLKNHAQSVLKMVKSLKQ 157 >gi|254780403|ref|YP_003064816.1| hypothetical protein CLIBASIA_01440 [Candidatus Liberibacter asiaticus str. psy62] Length = 80 Score = 22.7 bits (47), Expect = 3.0, Method: Compositional matrix adjust. Identities = 8/10 (80%), Positives = 9/10 (90%) Query: 101 KSYDVWKEKS 110 +YDVWKEKS Sbjct: 44 NAYDVWKEKS 53 >gi|254780384|ref|YP_003064797.1| serralysin [Candidatus Liberibacter asiaticus str. psy62] Length = 665 Score = 22.3 bits (46), Expect = 4.1, Method: Composition-based stats. Identities = 19/78 (24%), Positives = 33/78 (42%), Gaps = 13/78 (16%) Query: 19 DEQEISLLALGG-SKIV------------LYFYPKDDTSGCTAEAINFSSLKADFDEEST 65 + QE++ ALG SK+V + F ++ CT + ++ +FD+ Sbjct: 50 NAQEVARWALGEWSKVVDLTFEETSIHSDIKFISSNNGYVCTPRYDSRYFMEINFDKADV 109 Query: 66 ILIGISPDSIASHKKFHQ 83 GI +I SH H+ Sbjct: 110 WRYGIGKGTILSHNALHE 127 >gi|254780451|ref|YP_003064864.1| aconitate hydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 896 Score = 21.9 bits (45), Expect = 5.5, Method: Composition-based stats. Identities = 9/22 (40%), Positives = 14/22 (63%) Query: 24 SLLALGGSKIVLYFYPKDDTSG 45 S+L++GG V Y PK + +G Sbjct: 12 SILSVGGIDYVYYSLPKAEANG 33 >gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str. psy62] Length = 1828 Score = 21.2 bits (43), Expect = 8.9, Method: Compositional matrix adjust. Identities = 7/14 (50%), Positives = 13/14 (92%) Query: 139 VTLKNHAQSVLKMV 152 VTL+NH+Q++L+ + Sbjct: 884 VTLENHSQAMLEKI 897 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.131 0.370 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,197 Number of Sequences: 1233 Number of extensions: 3719 Number of successful extensions: 11 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 6 length of query: 157 length of database: 328,796 effective HSP length: 67 effective length of query: 90 effective length of database: 246,185 effective search space: 22156650 effective search space used: 22156650 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 35 (18.1 bits)