RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780213|ref|YP_003064626.1| hypothetical protein CLIBASIA_00490 [Candidatus Liberibacter asiaticus str. psy62] (63 letters) >gnl|CDD|146896 pfam04487, CITED, CITED. CITED, CBP/p300-interacting transactivator with ED-rich tail, are characterized by a conserved 32-amino acid sequence at the C-terminus. CITED proteins do not bind DNA directly and are thought to function as transcriptional co-activators. Length = 206 Score = 28.7 bits (64), Expect = 0.34 Identities = 11/17 (64%), Positives = 12/17 (70%), Gaps = 1/17 (5%) Query: 39 IDEEYLEKLVVE-SLDR 54 IDEE L LV+E LDR Sbjct: 159 IDEEVLMSLVLELGLDR 175 >gnl|CDD|30461 COG0112, GlyA, Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism]. Length = 413 Score = 25.1 bits (55), Expect = 4.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 27 VVSLPLSDDNMTIDEEYLEKLVVE 50 VVS + + ID + +EKL E Sbjct: 141 VVSYGVDPETGLIDYDEVEKLAKE 164 >gnl|CDD|32499 COG2352, Ppc, Phosphoenolpyruvate carboxylase [Energy production and conversion]. Length = 910 Score = 24.1 bits (52), Expect = 9.5 Identities = 8/33 (24%), Positives = 16/33 (48%) Query: 25 ISVVSLPLSDDNMTIDEEYLEKLVVESLDRSLR 57 +S + + L+ ++ + E Y + LV L L Sbjct: 792 LSNMEMVLAKSDLWLAEHYAQLLVDPELGERLF 824 >gnl|CDD|145953 pfam03074, GCS, Glutamate-cysteine ligase. This family represents the catalytic subunit of glutamate-cysteine ligase (E.C. 6.3.2.2), also known as gamma-glutamylcysteine synthetase (GCS). This enzyme catalyses the rate limiting step in the biosynthesis of glutathione. The eukaryotic enzyme is a dimer of a heavy chain and a light chain with all the catalytic activity exhibited by the heavy chain (this family). Length = 365 Score = 24.0 bits (52), Expect = 9.6 Identities = 13/47 (27%), Positives = 21/47 (44%), Gaps = 7/47 (14%) Query: 17 ILKEEIDDISVVSLPLS-------DDNMTIDEEYLEKLVVESLDRSL 56 I+K D I V D ++ I+E+ E+L+ E +D L Sbjct: 89 IIKSRYDSIDVYISKCKPNLEEYNDIDLPINEKIYEQLLDEGIDERL 135 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.313 0.133 0.362 Gapped Lambda K H 0.267 0.0604 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 738,638 Number of extensions: 28358 Number of successful extensions: 60 Number of sequences better than 10.0: 1 Number of HSP's gapped: 60 Number of HSP's successfully gapped: 7 Length of query: 63 Length of database: 6,263,737 Length adjustment: 35 Effective length of query: 28 Effective length of database: 5,507,422 Effective search space: 154207816 Effective search space used: 154207816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (23.7 bits)