BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780213|ref|YP_003064626.1| hypothetical protein CLIBASIA_00490 [Candidatus Liberibacter asiaticus str. psy62] (63 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780213|ref|YP_003064626.1| hypothetical protein CLIBASIA_00490 [Candidatus Liberibacter asiaticus str. psy62] Length = 63 Score = 123 bits (309), Expect = 4e-31, Method: Compositional matrix adjust. Identities = 63/63 (100%), Positives = 63/63 (100%) Query: 1 MGFITSLSKWDIEVNSILKEEIDDISVVSLPLSDDNMTIDEEYLEKLVVESLDRSLRCNY 60 MGFITSLSKWDIEVNSILKEEIDDISVVSLPLSDDNMTIDEEYLEKLVVESLDRSLRCNY Sbjct: 1 MGFITSLSKWDIEVNSILKEEIDDISVVSLPLSDDNMTIDEEYLEKLVVESLDRSLRCNY 60 Query: 61 EKK 63 EKK Sbjct: 61 EKK 63 >gi|254780947|ref|YP_003065360.1| transcription-repair coupling factor [Candidatus Liberibacter asiaticus str. psy62] Length = 1187 Score = 21.9 bits (45), Expect = 2.2, Method: Composition-based stats. Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 3/21 (14%) Query: 13 EVNSILKEEIDDISVVSLPLS 33 E+NS+LKEE I+ V LP++ Sbjct: 444 EINSLLKEE---IAAVILPIN 461 >gi|254780173|ref|YP_003064586.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Score = 21.9 bits (45), Expect = 2.2, Method: Composition-based stats. Identities = 10/28 (35%), Positives = 16/28 (57%) Query: 14 VNSILKEEIDDISVVSLPLSDDNMTIDE 41 +N I K + +I + +PL+DD I E Sbjct: 63 INHIEKHQAGEIIINGIPLNDDIRNIHE 90 >gi|254780902|ref|YP_003065315.1| isocitrate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 412 Score = 21.9 bits (45), Expect = 2.3, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 16/23 (69%) Query: 18 LKEEIDDISVVSLPLSDDNMTID 40 +K E D+S+ + L+DD +TID Sbjct: 37 IKIEYFDLSIQNRDLTDDQVTID 59 >gi|254780141|ref|YP_003064554.1| putative ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 208 Score = 21.6 bits (44), Expect = 2.8, Method: Compositional matrix adjust. Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 4/35 (11%) Query: 1 MGFITSLSKWDIEVNSILKEEIDDISVVSLPLSDD 35 + FI SL++ ++S EI D ++ SLPLSD+ Sbjct: 178 LHFIQSLNRAFSRISS----EIIDWTLSSLPLSDN 208 >gi|254780936|ref|YP_003065349.1| hypothetical protein CLIBASIA_04175 [Candidatus Liberibacter asiaticus str. psy62] Length = 182 Score = 21.2 bits (43), Expect = 3.3, Method: Compositional matrix adjust. Identities = 8/26 (30%), Positives = 17/26 (65%) Query: 16 SILKEEIDDISVVSLPLSDDNMTIDE 41 + L+ ++ +++VS LSD +M D+ Sbjct: 130 AALQRKVKKVTIVSTVLSDPSMASDQ 155 >gi|254781009|ref|YP_003065422.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter asiaticus str. psy62] Length = 750 Score = 20.8 bits (42), Expect = 4.1, Method: Compositional matrix adjust. Identities = 10/31 (32%), Positives = 15/31 (48%) Query: 28 VSLPLSDDNMTIDEEYLEKLVVESLDRSLRC 58 +SLP D +T+ +K +ES D R Sbjct: 178 ISLPFLKDVLTLGLANPKKYFIESRDNRFRA 208 >gi|254780227|ref|YP_003064640.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 426 Score = 20.8 bits (42), Expect = 4.2, Method: Compositional matrix adjust. Identities = 10/19 (52%), Positives = 14/19 (73%) Query: 18 LKEEIDDISVVSLPLSDDN 36 LKE+ +I+VV LP + DN Sbjct: 161 LKEKNYNITVVGLPKTIDN 179 >gi|254780284|ref|YP_003064697.1| hypothetical protein CLIBASIA_00845 [Candidatus Liberibacter asiaticus str. psy62] Length = 623 Score = 20.8 bits (42), Expect = 5.1, Method: Compositional matrix adjust. Identities = 18/66 (27%), Positives = 36/66 (54%), Gaps = 5/66 (7%) Query: 3 FITSLSKWDIEVNSILKEEIDDI-----SVVSLPLSDDNMTIDEEYLEKLVVESLDRSLR 57 F S++K+ ++S L+ + ++I +SL +D +T+D + LEK V+ SL Sbjct: 200 FSDSMAKYGTGMSSALEGKKENIFLADDQGISLKSKEDMLTLDIQSLEKSPVDDCGISLT 259 Query: 58 CNYEKK 63 + +K+ Sbjct: 260 ESPKKR 265 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.313 0.133 0.362 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,051 Number of Sequences: 1233 Number of extensions: 1287 Number of successful extensions: 13 Number of sequences better than 100.0: 13 Number of HSP's better than 100.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of query: 63 length of database: 328,796 effective HSP length: 34 effective length of query: 29 effective length of database: 286,874 effective search space: 8319346 effective search space used: 8319346 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.0 bits) S2: 31 (16.5 bits)