>cd01308 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hydrolyzes the beta-L-isoaspartyl linkages in dipeptides, as part of the degradative pathway to eliminate proteins with beta-L-isoaspartyl peptide bonds, bonds whereby the beta-group of an aspartate forms the peptide link with the amino group of the following amino acid. Formation of this bond is a spontaneous nonenzymatic reaction in nature and can profoundly effect the function of the protein. Isoaspartyl dipeptidase is an octameric enzyme that contains a binuclear zinc center in the active site of each subunit and shows a strong preference of hydrolyzing Asp-Leu dipeptides.

Probab=96.75 E-value=0.061 Score=33.64 Aligned_cols=65 Identities=15% Similarity=0.269 Sum_probs=42.4 Q ss_pred HHCCCCCCEEEEECCCCCCCCCCCCC------CCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH Q ss_conf 21056671798307866787776887------588244999999999872899899999999999998425 Q gi|254780215|r 192 ARGIPMDRVLVETDSPYIVPVSCQGK------RNEPAYVVNTAKALAKEKDVSYEDLMEETTKNALKLFSK 256 (262) Q Consensus 192 v~~iPldriLlETDsP~l~p~~~r~~------~n~P~~i~~~~~~iA~i~~~~~eei~~~~~~N~~~~f~~ 256 (262) T Consensus 271 ~~~i~~~~~~~~~d~~~~~~~~~~~g~~~~~~~g~~~t~~~~~~~~v~~g~l~le~av~~~T~NPAk~lgl 341 (387) T cd01308 271 EQGVPLERITFSSDGNGSLPKFDENGNLVGLGVGSVDTLLREVREAVKCGDIPLEVALRVITSNVARILKL 341 (387) T ss_pred HCCCCCCEEEEEECCCCCCCCCCCCCCEECCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCC T ss_conf 74998643999946999866410148551367675888999999999976999999999985899997499

HHsearch alignment for GI: 254780215 and conserved domain: cd01308