HHsearch alignment for GI: 254780217 and conserved domain: COG2874

>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion].
Probab=93.62  E-value=0.07  Score=34.80  Aligned_cols=156  Identities=22%  Similarity=0.276  Sum_probs=83.9

Q ss_pred             CCHHHHHHHHHHHHHCCCCC--EEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCHHHHHHHCCCCCC-
Q ss_conf             09299999999999828898--166311798988899999999998177998864312101267886799996789875-
Q gi|254780217|r   15 FGHEDIEKFLSQYYCSGRMH--HALLFEGEQGIGKATLGFRYAGHVLQNPDFSKAPVRMCNPDPCSPFVKQMASHALHD-   91 (347)
Q Consensus        15 ~G~~~~~~~L~~~~~~~~l~--ha~Lf~Gp~GiGK~~~A~~~A~~llc~~~~~~~~~~~~~~~~~~~~~~~i~~~~hpd-   91 (347)
T Consensus        12 ~gndelDkrLG-----GGiP~GsL~lIEGd~~tGKSvLsqr~~YG~L~~g~~v~yvsTe~---T~refi~qm~sl~ydv~   83 (235)
T COG2874          12 SGNDELDKRLG-----GGIPVGSLILIEGDNGTGKSVLSQRFAYGFLMNGYRVTYVSTEL---TVREFIKQMESLSYDVS   83 (235)
T ss_pred             CCCHHHHHHCC-----CCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECH---HHHHHHHHHHHCCCCCH
T ss_conf             78477786516-----99746769999888985488999999998870895489998403---59999998886388716


Q ss_pred             -------EEEECCCCHHHCCCCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCHH----HHHHHHHHHHHCCCC
Q ss_conf             -------453001000101342123237887554431022211112103532205542400----014567776630343
Q gi|254780217|r   92 -------FLYLSYSLNPKTGKWRTVITVDEIRRIRYFLSLTANTGYWRVIMIDPVDGMNRN----AANALLKSLEEPPQK  160 (347)
Q Consensus        92 -------~~~i~~~~~~k~~~~~~~I~vd~IR~l~~~~~~~~~~~~~Ki~IId~ad~ln~~----AaNALLK~LEEPp~~  160 (347)
T Consensus        84 ~~~l~G~l~~~~~~~~------~~~~~~~~~~~~L~~l~~~~k~~~~dViIIDSls~~~~~~~~~~vl~fm~~~r~l~d~  157 (235)
T COG2874          84 DFLLSGRLLFFPVNLE------PVNWGRRSARKLLDLLLEFIKRWEKDVIIIDSLSAFATYDSEDAVLNFMTFLRKLSDL  157 (235)
T ss_pred             HHHHCCEEEEEEECCC------CCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHCCCHHHHHHHHHHHHHHHHC
T ss_conf             8775062689993245------4225737789999999755775237789995343776526499999999999998728


Q ss_pred             CCEEEEECCCCCCCH----HHHCEEEEE
Q ss_conf             416765044335730----252036988
Q gi|254780217|r  161 VLFILISHASPTILS----TIRSRCLSI  184 (347)
Q Consensus       161 t~fiLit~~~~~il~----TI~SRc~~i  184 (347)
T Consensus       158 gKvIilTvhp~~l~e~~~~rirs~~d~~  185 (235)
T COG2874         158 GKVIILTVHPSALDEDVLTRIRSACDVY  185 (235)
T ss_pred             CCEEEEEECHHHCCHHHHHHHHHHHHEE
T ss_conf             9789999473433789999998752025