HHsearch alignment for GI: 254780217 and conserved domain: COG3854

>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown].
Probab=91.50  E-value=0.32  Score=29.49  Aligned_cols=42  Identities=26%  Similarity=0.445  Sum_probs=29.3

Q ss_pred             HHCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHH
Q ss_conf             6109299999999999828898166311798988899999999998
Q gi|254780217|r   13 RLFGHEDIEKFLSQYYCSGRMHHALLFEGEQGIGKATLGFRYAGHV   58 (347)
Q Consensus        13 ~i~G~~~~~~~L~~~~~~~~l~ha~Lf~Gp~GiGK~~~A~~~A~~l   58 (347)
T Consensus       120 ~v~Gt~~~--li~~ly~~g~ln--tLiigpP~~GKTTlLRdiaR~~  161 (308)
T COG3854         120 QVFGTANP--LIKDLYQNGWLN--TLIIGPPQVGKTTLLRDIARLL  161 (308)
T ss_pred             HHHCCCHH--HHHHHHHCCCEE--EEEECCCCCCHHHHHHHHHHHH
T ss_conf             56556218--899998437224--6996599887077999999986