HHsearch alignment for GI: 254780217 and conserved domain: COG5019

>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton].
Probab=91.27  E-value=1.3  Score=24.66  Aligned_cols=163  Identities=13%  Similarity=0.189  Sum_probs=76.5

Q ss_pred             HCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCHHHHHHHCCCCCCEE
Q ss_conf             10929999999999982889816631179898889999999999817799886431210126788679999678987545
Q gi|254780217|r   14 LFGHEDIEKFLSQYYCSGRMHHALLFEGEQGIGKATLGFRYAGHVLQNPDFSKAPVRMCNPDPCSPFVKQMASHALHDFL   93 (347)
Q Consensus        14 i~G~~~~~~~L~~~~~~~~l~ha~Lf~Gp~GiGK~~~A~~~A~~llc~~~~~~~~~~~~~~~~~~~~~~~i~~~~hpd~~   93 (347)
T Consensus         3 ~vgi~~l~~~r~~~~~k~Gi~f~im~~G~sG~GKttfiNtL~~~~l~~~~~~~~----~~-----------~~~~~~~~~   67 (373)
T COG5019           3 YVGISNLPNQRHRKLSKKGIDFTIMVVGESGLGKTTFINTLFGTSLVDETEIDD----IR-----------AEGTSPTLE   67 (373)
T ss_pred             CCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCC----CC-----------CCCCCCCEE
T ss_conf             677475427888999855996389996278875557887656765257777557----66-----------666776258


Q ss_pred             EECC--CCHHHCCCCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCHHH----HHHHHH-HHHHCCCCCCEEEE
Q ss_conf             3001--0001013421232378875544310222111121035322055424000----145677-76630343416765
Q gi|254780217|r   94 YLSY--SLNPKTGKWRTVITVDEIRRIRYFLSLTANTGYWRVIMIDPVDGMNRNA----ANALLK-SLEEPPQKVLFILI  166 (347)
Q Consensus        94 ~i~~--~~~~k~~~~~~~I~vd~IR~l~~~~~~~~~~~~~Ki~IId~ad~ln~~A----aNALLK-~LEEPp~~t~fiLi  166 (347)
T Consensus        68 i~~~~~~l~e~--~~~~~l~vIDtpGfGD~idN---s~~we~-I~~yI~~q~d~yl~~E~~~~R~~~~~D~RVH~cLYFI  141 (373)
T COG5019          68 IKITKAELEED--GFHLNLTVIDTPGFGDFIDN---SKCWEP-IVDYIDDQFDQYLDEEQKIKRNPKFKDTRVHACLYFI  141 (373)
T ss_pred             EEEEEEEEECC--CEEEEEEEECCCCCCCCCCC---CCCHHH-HHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEE
T ss_conf             88643166048--74898888615886565464---101799-9999999999999986434556654468248999984


Q ss_pred             ECCCCCCCH-------HHHCEEEEEEC----CCCCHHHHHHH
Q ss_conf             044335730-------25203698864----79998999999
Q gi|254780217|r  167 SHASPTILS-------TIRSRCLSIKF----NSLSENNLYKA  197 (347)
Q Consensus       167 t~~~~~il~-------TI~SRc~~i~f----~~l~~~~~~~~  197 (347)
T Consensus       142 ~Ptgh~l~~~DIe~Mk~ls~~vNlIPVI~KaD~lT~~El~~~  183 (373)
T COG5019         142 RPTGHGLKPLDIEAMKRLSKRVNLIPVIAKADTLTDDELAEF  183 (373)
T ss_pred             CCCCCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHH
T ss_conf             689887878889999998533675656624665899999999