HHsearch alignment for GI: 254780217 and conserved domain: PHA00729

>PHA00729 NTP-binding motif containing protein.
Probab=90.60  E-value=0.3  Score=29.68  Aligned_cols=37  Identities=24%  Similarity=0.362  Sum_probs=29.9

Q ss_pred             HHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHC
Q ss_conf             99999982889816631179898889999999999817
Q gi|254780217|r   23 FLSQYYCSGRMHHALLFEGEQGIGKATLGFRYAGHVLQ   60 (347)
Q Consensus        23 ~L~~~~~~~~l~ha~Lf~Gp~GiGK~~~A~~~A~~llc   60 (347)
T Consensus         7 kIi~a~~~~GF~-S~iifGkQG~GKTTYAlKV~~~v~~   43 (228)
T PHA00729          7 KIISAYNTNGFV-SAIIFGKQGTGKTTYALKVARDVFW   43 (228)
T ss_pred             HHHHHHHCCCCE-EEEEECCCCCCCEEEHHHHHHHHHH
T ss_conf             999998647946-9999836778842021999999999