HHsearch alignment for GI: 254780217 and conserved domain: PRK04841

>PRK04841 transcriptional regulator MalT; Provisional.
Probab=97.87  E-value=0.00041  Score=52.76  Aligned_cols=204  Identities=16%  Similarity=0.171  Sum_probs=116.4

Q ss_pred             CCC-CCCCHHHHCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCHHHH
Q ss_conf             555-5875656109299999999999828898166311798988899999999998177998864312101267886799
Q gi|254780217|r    4 RAF-DPVYNQRLFGHEDIEKFLSQYYCSGRMHHALLFEGEQGIGKATLGFRYAGHVLQNPDFSKAPVRMCNPDPCSPFVK   82 (347)
Q Consensus         4 ~~~-~p~~~~~i~G~~~~~~~L~~~~~~~~l~ha~Lf~Gp~GiGK~~~A~~~A~~llc~~~~~~~~~~~~~~~~~~~~~~   82 (347)
T Consensus         5 tK~~pP~~~~~~v~R~rL~~~L~~~-~~~~l---~lv~APaG~GKTtl~a~w~~~---~~~~~Wlsld~~d~~~~~-f~~   76 (903)
T PRK04841          5 SKLSRPVRLDHTVVRERLLAKLSGA-NNYRL---VLVRSPAGYGKTTLASQWAAG---KNNVGWYSLDESDNQPER-FAS   76 (903)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHH-CCCCE---EEEECCCCCCHHHHHHHHHHC---CCCEEEEECCCCCCCHHH-HHH
T ss_conf             2568999987825547799999851-58997---999779998899999999834---998599858854489999-999


Q ss_pred             HH-HC--CCCCCEEEECCCCHHHCCCCCCCCCHHHH-HHHHHHCCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHH-HHHC
Q ss_conf             99-67--89875453001000101342123237887-55443102221111210353220554240001456777-6630
Q gi|254780217|r   83 QM-AS--HALHDFLYLSYSLNPKTGKWRTVITVDEI-RRIRYFLSLTANTGYWRVIMIDPVDGMNRNAANALLKS-LEEP  157 (347)
Q Consensus        83 ~i-~~--~~hpd~~~i~~~~~~k~~~~~~~I~vd~I-R~l~~~~~~~~~~~~~Ki~IId~ad~ln~~AaNALLK~-LEEP  157 (347)
T Consensus        77 ~l~~al~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~l~~~l~~---~~~~~~lvlDD~h~i~~~~~~~~l~~Ll~~~  149 (903)
T PRK04841         77 YLIAALQQATNGHCSKSEALAE----KRQYASLTSLFAQLFIELSD---WHQPLYLVLDDYHLITNPEIHEAMRFFLRHQ  149 (903)
T ss_pred             HHHHHHHHHCCCCCCHHHHCCC----CCCCCCHHHHHHHHHHHHHC---CCCCEEEEEECCCCCCCHHHHHHHHHHHHHC
T ss_conf             9999999856543311231135----56655499999999999755---8998699986836488868999999999838


Q ss_pred             CCCCCEEEEECCCCCC-CHHHHCEEEEEECC----CCCHHHHHHHHHH-HCCCCCHHHHHHHHHHCCCCHH
Q ss_conf             3434167650443357-30252036988647----9998999999997-2788896789999997598978
Q gi|254780217|r  158 PQKVLFILISHASPTI-LSTIRSRCLSIKFN----SLSENNLYKALEQ-LKIMGWDSKRDFVKIAAYGSVA  222 (347)
Q Consensus       158 p~~t~fiLit~~~~~i-l~TI~SRc~~i~f~----~l~~~~~~~~L~~-~~~~~~~~~~~~~~~~s~Gs~~  222 (347)
T Consensus       150 p~~l~lvl~sR~~p~l~l~~l~~~~~l~~i~~~dL~Ft~~E~~~~~~~~~g~~l~~~~~~~l~~~TeGW~a  220 (903)
T PRK04841        150 PENLTLVVLSRNLPPLGIANLRVRDQLLEIGSQQLAFDHQEAQQFFDQRLSSPIEAAESSRLCDRVEGWPT  220 (903)
T ss_pred             CCCEEEEEEECCCCCCCHHHHHHCCEEEEECHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCHHH
T ss_conf             98838998768999875245774595699868875999999999998625999999999999997087899