>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=93.26 E-value=0.13 Score=32.75 Aligned_cols=46 Identities=17% Similarity=0.274 Sum_probs=30.9 Q ss_pred CCHHHHHHHHH-HCCHHHHHHHHHHHHHCC-CCCCEEEEECCCCCCCH Q ss_conf 21035322055-424000145677766303-43416765044335730 Q gi|254780217|r 130 YWRVIMIDPVD-GMNRNAANALLKSLEEPP-QKVLFILISHASPTILS 175 (347) Q Consensus 130 ~~Ki~IId~ad-~ln~~AaNALLK~LEEPp-~~t~fiLit~~~~~il~ 175 (347) T Consensus 98 ~p~ililDEPtsgLD~~~~~~l~~~i~~l~~~g~tii~vtH~~~~~~~ 145 (157) T cd00267 98 NPDLLLLDEPTSGLDPASRERLLELLRELAEEGRTVIIVTHDPELAEL 145 (157) T ss_pred CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHH T ss_conf 999999969876689999999999999999689999999089999999

HHsearch alignment for GI: 254780217 and conserved domain: cd00267