>cd01377 MYSc_type_II Myosin motor domain, type II myosins. Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydro

Probab=91.24  E-value=0.37  Score=28.99  Aligned_cols=31  Identities=23%  Similarity=0.342  Sum_probs=27.1

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHC
Q ss_conf             2889816631179898889999999999817
Q gi|254780217|r   30 SGRMHHALLFEGEQGIGKATLGFRYAGHVLQ   60 (347)
Q Consensus        30 ~~~l~ha~Lf~Gp~GiGK~~~A~~~A~~llc   60 (347)
T Consensus        87 ~~~~~QsIiiSGESGAGKTes~K~il~yL~~  117 (693)
T cd01377          87 QDRENQSILITGESGAGKTENTKKVIQYLAS  117 (693)
T ss_pred             HCCCCCEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             7499806999688988889999999999999