>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein. In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=96.04 E-value=0.0098 Score=41.67 Aligned_cols=52 Identities=15% Similarity=0.213 Sum_probs=35.8 Q ss_pred CCHHHHHHHHH-HCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHCEEEEEEC Q ss_conf 21035322055-4240001456777663034341676504433573025203698864 Q gi|254780217|r 130 YWRVIMIDPVD-GMNRNAANALLKSLEEPPQKVLFILISHASPTILSTIRSRCLSIKF 186 (347) Q Consensus 130 ~~Ki~IId~ad-~ln~~AaNALLK~LEEPp~~t~fiLit~~~~~il~TI~SRc~~i~f 186 (347) T Consensus 157 ~~~illlDEpts~LD~~t~~~i~~~l~~~~~~~TvI~itH~~~~-----~~~~D~iiv 209 (229) T cd03254 157 DPKILILDEATSNIDTETEKLIQEALEKLMKGRTSIIIAHRLST-----IKNADKILV 209 (229) T ss_pred CCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHH-----HHHCCEEEE T ss_conf 89989998977789989999999999998099889999269889-----985999999

HHsearch alignment for GI: 254780217 and conserved domain: cd03254