BLAST/PSIBLAST alignment of GI: 254780217 and GI: 116252222 at iteration 1
>gi|116252222|ref|YP_768060.1| DNA polymerase III subunit delta' [Rhizobium leguminosarum bv. viciae 3841] Length = 341
>gi|115256870|emb|CAK07964.1| putative DNA polymerase III, delta' subunit [Rhizobium leguminosarum bv. viciae 3841] Length = 341
 Score =  296 bits (757), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 147/335 (43%), Positives = 216/335 (64%), Gaps = 4/335 (1%)

Query: 1   MIDRAFDPVYNQRLFGHEDIEKFLSQYYCSGRMHHALLFEGEQGIGKATLGFRYAGHVLQ 60
           ++D A  P  N RLFGH + E FL+Q Y SG+ HHA+L EG +GIGKATL FR+A HVL 
Sbjct: 8   LLDGAIWPGENTRLFGHAEAEAFLAQSYRSGKGHHAVLIEGPEGIGKATLAFRFANHVLS 67

Query: 61  NPDFSKAPVRMCNPDPCSPFVKQMASHALHDFLYLSYSLNPKTGKWRTVITVDEIRRIRY 120
           +PD   AP  + +PD  S   +Q+AS A H+ L+L+  ++ KTGK ++ ITVDE+RR   
Sbjct: 68  HPDPETAPETIGDPDLASSVSRQIASGASHNLLHLARPVDEKTGKVKSAITVDEVRRAGK 127

Query: 121 FLSLTANTGYWRVIMIDPVDGMNRNAANALLKSLEEPPQKVLFILISHASPTILSTIRSR 180
           F S T+ TG WR+++IDP D MNRNAANA+LK LEEPP++ LF+++SHA   +L TIRSR
Sbjct: 128 FFSQTSGTGNWRIVIIDPADDMNRNAANAILKILEEPPKRALFLVLSHAPGRLLPTIRSR 187

Query: 181 CLSIKFNSLSENNLYKALEQLKIMGWDSKRDFVKIAAYGSVARAIKILHYDCDKIISSYI 240
           CL +K   L+++ L  AL  L I G   +   V  AA GSV  A+K+L+Y   +II++Y 
Sbjct: 188 CLPLKLAPLADDELVAALAHLGISG---EGGAVLSAAKGSVGEALKLLNYGGGEIIAAYD 244

Query: 241 DLIHIPRQEYALQKMQQIADELLSQDQKIAFDFLIEFILKEICKSAKAAALSGQLEEADQ 300
           +++       A + M ++AD L  ++    FDF +  +  +I   A+AAA  GQ+  A++
Sbjct: 245 EML-AAEGPTARKAMHRLADALSGRESDTIFDFFVSHVGDDIMNRARAAAGEGQIAAAER 303

Query: 301 IAQIYFSLVKRVHAFSMYNLDRRQMIFHLLSKARE 335
           +A++Y  + +R+     YNLDR+Q I  +L+  ++
Sbjct: 304 LARLYSEITERLTISDGYNLDRKQTIISILADIKQ 338