RPSBLAST alignment for GI: 254780217 and conserved domain: PRK04132

>gnl|CDD|179744 PRK04132, PRK04132, replication factor C small subunit; Provisional. Length = 846
 Score = 42.9 bits (101), Expect = 1e-04
 Identities = 30/105 (28%), Positives = 52/105 (49%), Gaps = 8/105 (7%)

Query: 131 WRVIMIDPVDGMNRNAANALLKSLEEPPQKVLFILISHASPTILSTIRSRCLSIKFNSLS 190
           +++I +D  D + ++A  AL +++E     V FIL  + S  I+  I+SRC   +F  L 
Sbjct: 631 FKIIFLDEADALTQDAQQALRRTMEMFSSNVRFILSCNYSSKIIEPIQSRCAIFRFRPLR 690

Query: 191 ENNLYKAL------EQLKIMGWDSKRDFVKIAAYGSVARAIKILH 229
           + ++ K L      E L++   +     +   A G + RAI IL 
Sbjct: 691 DEDIAKRLRYIAENEGLELT--EEGLQAILYIAEGDMRRAINILQ 733