HHsearch alignment for GI: 254780218 and conserved domain: COG0378

>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription].
Probab=95.49  E-value=0.029  Score=33.80  Aligned_cols=36  Identities=36%  Similarity=0.460  Sum_probs=29.9

Q ss_pred             CCC-CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             888-6899867888797999999999999779819998
Q gi|254780218|r    2 NSG-LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVT   38 (225)
Q Consensus         2 ~~g-~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~   38 (225)
T Consensus        10 ~~~~~~i~v~Gp~GSGKTaLie~~~~~L~~~-~~~aVI   46 (202)
T COG0378          10 NRPMLRIGVGGPPGSGKTALIEKTLRALKDE-YKIAVI   46 (202)
T ss_pred             CCCEEEEEECCCCCCCHHHHHHHHHHHHHHH-CCEEEE
T ss_conf             5864899961799867899999999999752-776899