HHsearch alignment for GI: 254780218 and conserved domain: COG1341

>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only].
Probab=97.32  E-value=0.0044  Score=38.64  Aligned_cols=119  Identities=20%  Similarity=0.224  Sum_probs=60.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEE-CCC----------------CCCCCCHHHHCCCC--CCCCCCHHHH
Q ss_conf             8998678887979999999999997798199987-788----------------98441001100124--4454101345
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTR-EPG----------------GTPAAEAARHVLLS--CGVDEFGAEA   66 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~-eP~----------------~t~~ge~ir~~l~~--~~~~~~~~~~   66 (225)
T Consensus        75 ~vmvvG~vDSGKSTLt~~LaN~~l~rG~~v~iiDaDvGQ~ei~pPg~ISL~~~~s~~~~--L~~l~~~~~~FvG~isP~~  152 (398)
T COG1341          75 VVMVVGPVDSGKSTLTTYLANKLLARGRKVAIIDADVGQSEIGPPGFISLAFPESPVIS--LSELEPFTLYFVGSISPQG  152 (398)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCEEEEECCCCCCCC--HHHCCCCCEEEEECCCCCC
T ss_conf             89998986767889999999887644741899968999766679746774125677777--7775865227985147777


Q ss_pred             HHHHHHH--HHHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHH
Q ss_conf             6777889--9999776356554234525872354243100010034442457765444203889841156652034877
Q gi|254780218|r   67 EAIVFAA--ARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIG  143 (225)
Q Consensus        67 ~~lLfaa--dr~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a  143 (225)
T Consensus       153 ~~~~~i~~v~rL--~~~----a~~~~~~ilIdT---~GWi~-----G~~g~el---k~~li~~ikP~~Ii~l~~~~~~~  214 (398)
T COG1341         153 FPGRYIAGVARL--VDL----AKKEADFILIDT---DGWIK-----GWGGLEL---KRALIDAIKPDLIIALERANELS  214 (398)
T ss_pred             CHHHHHHHHHHH--HHH----HHCCCCEEEECC---CCCEE-----CCHHHHH---HHHHHHHCCCCEEEEECCCCCCC
T ss_conf             768999999999--998----651687799969---98430-----7427899---99988650977899931445323