HHsearch alignment for GI: 254780218 and conserved domain: COG2256

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair].
Probab=94.51  E-value=0.03  Score=33.72  Aligned_cols=85  Identities=18%  Similarity=0.250  Sum_probs=43.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCC-CCHHHHHHHHHHHHHHH-HHHHHHH
Q ss_conf             998678887979999999999997798199987788984410011001244454-10134567778899999-7763565
Q gi|254780218|r    7 ISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVD-EFGAEAEAIVFAAARLD-HVENVIR   84 (225)
Q Consensus         7 I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~-~~~~~~~~lLfaadr~~-~~~~~I~   84 (225)
T Consensus        51 mIl~GPPG~GKTTlA~liA~~~~---~~f~~~s--Av~~gvkdlr~i~e~a~~~~~~gr~tiLflDEIHRfnK~QQD~lL  125 (436)
T COG2256          51 MILWGPPGTGKTTLARLIAGTTN---AAFEALS--AVTSGVKDLREIIEEARKNRLLGRRTILFLDEIHRFNKAQQDALL  125 (436)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHC---CCEEEEC--CCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEHHHHCCHHHHHHHH
T ss_conf             57778999888899999987617---7669951--523467999999999999872588349987225333744565510


Q ss_pred             HHHCCCCEEEEC
Q ss_conf             542345258723
Q gi|254780218|r   85 PALMEGKILLCD   96 (225)
Q Consensus        85 p~L~~g~iVI~D   96 (225)
T Consensus       126 p~vE~G~iilIG  137 (436)
T COG2256         126 PHVENGTIILIG  137 (436)
T ss_pred             HHHCCCEEEEEE
T ss_conf             332488689996