HHsearch alignment for GI: 254780218 and conserved domain: COG4088

>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism].
Probab=99.21  E-value=3.6e-10  Score=80.99  Aligned_cols=155  Identities=21%  Similarity=0.251  Sum_probs=91.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCC-HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6899867888797999999999999779819998778898441001100124445410-134567778899999776356
Q gi|254780218|r    5 LFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEF-GAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus         5 ~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~-~~~~~~lLfaadr~~~~~~~I   83 (225)
T Consensus         2 pLiIlTGyPgsGKTtfakeLak~L~~~i~~vi~l~-------kdy~~~i~~DEslpi~ke~yres~~------ks~~rll   68 (261)
T COG4088           2 PLIILTGYPGSGKTTFAKELAKELRQEIWRVIHLE-------KDYLRGILWDESLPILKEVYRESFL------KSVERLL   68 (261)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCC-------HHHHHHEECCCCCCHHHHHHHHHHH------HHHHHHH
T ss_conf             56998269998801789999999997200112132-------0145412331324037999999998------8899999


Q ss_pred             HHHHCCCCEEEECC-CCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHH
Q ss_conf             55423452587235-42431000100344424577654442038898411566520348776443211111000000002
Q gi|254780218|r   84 RPALMEGKILLCDR-FLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYF  162 (225)
Q Consensus        84 ~p~L~~g~iVI~DR-y~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~  162 (225)
T Consensus        69 dSalk-n~~VIvDdtNYyksmRrqL~-------------ceak~~~tt~ciIyl~~plDtc~rrN~ergepi--------  126 (261)
T COG4088          69 DSALK-NYLVIVDDTNYYKSMRRQLA-------------CEAKERKTTWCIIYLRTPLDTCLRRNRERGEPI--------  126 (261)
T ss_pred             HHHHC-CEEEEEECCCHHHHHHHHHH-------------HHHHHCCCCEEEEEECCCHHHHHHHHCCCCCCC--------
T ss_conf             99863-64999706328889999999-------------999863786599997268899988602479999--------


Q ss_pred             HHCCHHHHHHHHHHHHHHHHHCC-CC----EEEEC----CCCCHHHH
Q ss_conf             11288999999999999999789-94----99981----89788999
Q gi|254780218|r  163 ERKDVMIHEKRRQIFLDIARNQP-DR----CHIVD----SAHSFQSV  200 (225)
Q Consensus       163 E~~~~~~~~kv~~~y~~la~~~~-~~----~~~ID----a~~~~eei  200 (225)
T Consensus       127 ---p~Evl~qly~RfEe---Pn~~~rWDspll~id~~d~~t~~IDfi  167 (261)
T COG4088         127 ---PEEVLRQLYDRFEE---PNPDRRWDSPLLVIDDSDVSTEVIDFI  167 (261)
T ss_pred             ---CHHHHHHHHHHHCC---CCCCCCCCCCEEEEECCCCCCCCHHHH
T ss_conf             ---89999999996149---997765567637886355544413678