HHsearch alignment for GI: 254780218 and conserved domain: KOG3062

>KOG3062 consensus.
Probab=98.40  E-value=1.9e-05  Score=52.81  Aligned_cols=163  Identities=15%  Similarity=0.185  Sum_probs=85.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCC-EEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89986788879799999999999977981-99987788984410011001244454101345677788999997763565
Q gi|254780218|r    6 FISFEGIEGAGKTTHISLLKRFLQRKNYD-VHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVIR   84 (225)
Q Consensus         6 ~I~iEGiDGsGKsTq~~~L~~~L~~~g~~-v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I~   84 (225)
T Consensus         3 LVvi~G~P~SGKstrA~~L~~~l~~~~~K~~v~ii~d--eslg------~~-~ns~y~~s~~EK----~lRg~L~S~-v~   68 (281)
T KOG3062           3 LVVICGLPCSGKSTRAVELREALKERGTKQSVRIIDD--ESLG------IE-KNSNYGDSQAEK----ALRGKLRSA-VD   68 (281)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECH--HHCC------CC-CCCCCCCCHHHH----HHHHHHHHH-HH
T ss_conf             6999378888820679999999986255514999541--3217------88-742224457788----889989999-98


Q ss_pred             HHHCCCCEEEECCCCC-CCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             5423452587235424-310001003444245776544420388984115665203487764432111110000000021
Q gi|254780218|r   85 PALMEGKILLCDRFLD-SSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACLDYFE  163 (225)
Q Consensus        85 p~L~~g~iVI~DRy~~-S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~d~~E  163 (225)
T Consensus        69 R~Lsk~~iVI~DslNyIKGfRYeLyC----------~ak~~---~tt~Cvv~t~vp~e~~r~~Ns~~~~p~e~g----y-  130 (281)
T KOG3062          69 RSLSKGDIVIVDSLNYIKGFRYELYC----------EAKAA---RTTYCVVHTAVPQELCREWNSEREDPGEDG----Y-  130 (281)
T ss_pred             HHCCCCCEEEEECCCCCCCCEEEEEE----------EHHCC---CEEEEEEEECCCHHHHHHHCCCCCCCCCCC----C-
T ss_conf             53356868998144411220203655----------10105---446899985279899987514689988899----9-


Q ss_pred             HCCHHHHHHHHHHHHHHHHHCCCCE-----EEE--CCCCCHHHHHHHH
Q ss_conf             1288999999999999999789949-----998--1897889999999
Q gi|254780218|r  164 RKDVMIHEKRRQIFLDIARNQPDRC-----HIV--DSAHSFQSVATNI  204 (225)
Q Consensus       164 ~~~~~~~~kv~~~y~~la~~~~~~~-----~~I--Da~~~~eei~~~I  204 (225)
T Consensus       131 --~~e~le~L~~RyEeP--~s~NRWDsPLf~ll~~~~~~~~~~I~~al  174 (281)
T KOG3062         131 --DDELLEALVQRYEEP--NSRNRWDSPLFTLLPDVITLPIDDILKAL  174 (281)
T ss_pred             --CHHHHHHHHHHHHCC--CCCCCCCCCCEEEECCCCCCCHHHHHHHH
T ss_conf             --979999999986187--75566668615772465778689999998