HHsearch alignment for GI: 254780218 and conserved domain: KOG3308

>KOG3308 consensus.
Probab=97.73  E-value=0.0004  Score=44.87  Aligned_cols=184  Identities=19%  Similarity=0.175  Sum_probs=88.2

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEC---CCC-CCCC-------------------CHHHHCCCCC
Q ss_conf             9888689986788879799999999999977981999877---889-8441-------------------0011001244
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTRE---PGG-TPAA-------------------EAARHVLLSC   57 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~e---P~~-t~~g-------------------e~ir~~l~~~   57 (225)
T Consensus         1 s~K~~ivgiSG~TnsGKTTLak~l~~~f~~~--~lIhqDDFyKp~~Ei~v~~~n~~~wd~~esLdm~~fl~~ia~~l~~~   78 (225)
T KOG3308           1 SMKTLIVGISGCTNSGKTTLAKSLHRFFPGC--SLIHQDDFYKPENEIEVDYNNIDNWDLLESLDMEKFLEKIATWLDSR   78 (225)
T ss_pred             CCEEEEEEEECCCCCCHHHHHHHHHHHCCCC--EEECCCCCCCCHHHHHCCCCCCCHHCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             9618999864246787768999999873687--46402234675534211237721110131420999987888885075


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEE
Q ss_conf             45410134567778899999776356554234525872354243100010034442457765444203889841156652
Q gi|254780218|r   58 GVDEFGAEAEAIVFAAARLDHVENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILD  137 (225)
Q Consensus        58 ~~~~~~~~~~~lLfaadr~~~~~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ld  137 (225)
T Consensus        79 --~~~~~ar~~~v~~~~-~~~~~~~~q~~~~~~~iviidGfmi----y~y-------~p~~~---------~~d~~im~~  135 (225)
T KOG3308          79 --HNAPEAREHLVSYAN-FEHYAQQFQIKAYKNHIVIIDGFMI----YNY-------KPQVD---------LFDRIIMLT  135 (225)
T ss_pred             --CCCCHHHHHHHHHHH-HHHHHHHCCCCCCCCCEEEEECCEE----EEC-------CHHHH---------HHHHHEEEE
T ss_conf             --556337565411667-7777642275200276799836147----726-------32664---------555210220


Q ss_pred             ECHHHHHHHHHHHHHHHHCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             0348776443211111000000002112889999999999999997899499981897889999999999999998
Q gi|254780218|r  138 LPVDIGLKRVQNRYSLRESACLDYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQ  213 (225)
Q Consensus       138 v~~e~a~~Ri~~R~~~~~~~~~d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l~  213 (225)
T Consensus       136 ~~y~~~krRr~~Rt~y~p~~t-gyfd~~~~P~Y~~~~~~~~d~~~---h~~~flngdvs~e~~~~~v~~~i~~~~~  207 (225)
T KOG3308         136 LDYETCKRRREARTYYPPDDT-GYFDPVVWPHYEKNFEEARDRSR---HDSLFLNGDVSEEKLDDKVNESINQRQQ  207 (225)
T ss_pred             CCHHHHHHHHCCCCCCCCCCC-CCCCCCCCHHHHHHHHHHHHHCC---CCEEEECCCCHHHHCHHHHHHHHCCCCC
T ss_conf             439999876236544777877-52357646089887888875034---4315552520132232565430100212