HHsearch alignment for GI: 254780218 and conserved domain: KOG3327

>KOG3327 consensus.
Probab=100.00  E-value=2e-41  Score=267.51  Aligned_cols=199  Identities=24%  Similarity=0.346  Sum_probs=172.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC-CCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             988868998678887979999999999997798199987788-9844100110012444541013456777889999977
Q gi|254780218|r    1 MNSGLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPG-GTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHV   79 (225)
Q Consensus         1 M~~g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~-~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~   79 (225)
T Consensus         2 ~~rg~liV~eGlDrsgKstQ~~~l~~~l~~~~~~~~l~~FP~Rst~iGk~i~~YL~k--~~dl~d~~iHLlFSAnRwe~~   79 (208)
T KOG3327           2 MIRGALIVLEGLDRSGKSTQCGKLVESLIPGLDPAELLRFPERSTSIGKLIDGYLRK--KSDLPDHTIHLLFSANRWEHV   79 (208)
T ss_pred             CCCCCEEEEECCCCCCCEEEHHHHHHHHHHCCCHHHHHHCCHHCCCCCHHHHHHHHH--CCCCCHHHHHHHHCCCHHHHH
T ss_conf             987617765321347745206679999870567577661510004411778999874--157737899997605316679


Q ss_pred             HHHHHHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHH
Q ss_conf             63565542345258723542431000100344424577654442038898411566520348776443211111000000
Q gi|254780218|r   80 ENVIRPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYSLRESACL  159 (225)
Q Consensus        80 ~~~I~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~~~~~~~~  159 (225)
T Consensus        80 ~~-i~e~l~kg~~~ivDRY~~SGvAyS~AK-gl~---~dWc~~pd~gL~KPDlvlfL~v~p~~~a~r--------ggfG~  146 (208)
T KOG3327          80 SL-IKEKLAKGTTLIVDRYSFSGVAYSAAK-GLD---LDWCKQPDVGLPKPDLVLFLDVSPEDAARR--------GGFGE  146 (208)
T ss_pred             HH-HHHHHHCCCEEEEECCEECCHHHHHHC-CCC---CCHHHCCCCCCCCCCEEEEEECCHHHHHHH--------CCCCH
T ss_conf             99-999985498299963430104666423-788---623338765898988689973798999874--------47654


Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             002112889999999999999997899499981897889999999999999998642
Q gi|254780218|r  160 DYFERKDVMIHEKRRQIFLDIARNQPDRCHIVDSAHSFQSVATNILNIVWELVQKRV  216 (225)
Q Consensus       160 d~~E~~~~~~~~kv~~~y~~la~~~~~~~~~IDa~~~~eei~~~I~~~i~~~l~k~~  216 (225)
T Consensus       147 Erye--~v~fqekv~~~~q~l~r~e~~~~~~vDAs~sve~V~~~V~~i~e~~~~~~~  201 (208)
T KOG3327         147 ERYE--TVAFQEKVLVFFQKLLRKEDLNWHVVDASKSVEKVHQQVRSLVENVLSEPI  201 (208)
T ss_pred             HHHH--HHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHHCCCCC
T ss_conf             6777--789999999999999844588758974672599999999999987305777