HHsearch alignment for GI: 254780218 and conserved domain: KOG3347

>KOG3347 consensus.
Probab=98.03  E-value=0.00013  Score=47.82  Aligned_cols=109  Identities=18%  Similarity=0.260  Sum_probs=65.9

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             86899867888797999999999999779819998778898441001100124445410134567778899999776356
Q gi|254780218|r    4 GLFISFEGIEGAGKTTHISLLKRFLQRKNYDVHVTREPGGTPAAEAARHVLLSCGVDEFGAEAEAIVFAAARLDHVENVI   83 (225)
Q Consensus         4 g~~I~iEGiDGsGKsTq~~~L~~~L~~~g~~v~~~~eP~~t~~ge~ir~~l~~~~~~~~~~~~~~lLfaadr~~~~~~~I   83 (225)
T Consensus         7 ~PNILvtGTPG~GKstl~~~lae~~---~~~~i~--------isd~vkEn~l~---~gyDE~y~c~i~DEd---kv~D~L   69 (176)
T KOG3347           7 RPNILVTGTPGTGKSTLAERLAEKT---GLEYIE--------ISDLVKENNLY---EGYDEEYKCHILDED---KVLDEL   69 (176)
T ss_pred             CCCEEEECCCCCCCHHHHHHHHHHH---CCCEEE--------HHHHHHHHCCH---HCCCCCCCCCCCCHH---HHHHHH
T ss_conf             7887986799988025999999973---985674--------55677661102---102322367545678---999888


Q ss_pred             HHHHCCCCEEEECCCCCCCEEHHCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             554234525872354243100010034442457765444203889841156652034877644321111
Q gi|254780218|r   84 RPALMEGKILLCDRFLDSSYAYQGERDSSQHLFLDSLQEISVQEVMPDCTIILDLPVDIGLKRVQNRYS  152 (225)
Q Consensus        84 ~p~L~~g~iVI~DRy~~S~lAYQ~~~~~~~~~~i~~l~~~~~~~~~PDl~i~Ldv~~e~a~~Ri~~R~~  152 (225)
T Consensus        70 e~~m~~Gg~I-VD--------yH----gCd~Fper----------wfdlVvVLr~~~s~LY~RL~sRgY  115 (176)
T KOG3347          70 EPLMIEGGNI-VD--------YH----GCDFFPER----------WFDLVVVLRTPNSVLYDRLKSRGY  115 (176)
T ss_pred             HHHHHCCCCE-EE--------EC----CCCCCCHH----------HEEEEEEEECCCHHHHHHHHHCCC
T ss_conf             8987568848-86--------00----56765011----------355799994684599999997588